KEGG   Conexibacter woesei: Cwoe_4158
Entry
Cwoe_4158         CDS       T01153                                 

Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) synthase 2
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
cwo  Conexibacter woesei
Pathway
cwo00061  Fatty acid biosynthesis
cwo00780  Biotin metabolism
cwo01100  Metabolic pathways
cwo01212  Fatty acid metabolism
cwo01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:cwo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Cwoe_4158
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Cwoe_4158
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cwo01004]
    Cwoe_4158
Enzymes [BR:cwo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     Cwoe_4158
Lipid biosynthesis proteins [BR:cwo01004]
 Fatty acid synthase
  Component type
   Cwoe_4158
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N Thiolase_C KAsynt_C_assoc
Other DBs
NCBI-ProteinID: ADB52573
UniProt: D3F5M4
LinkDB
Position
complement(4421903..4423108)
AA seq 401 aa
MKRRVVITGVGAVTPLGVGAEPLLRRWAAGESGIVDGEGACRDYVAKEHLSVKEARRADR
FAQLAMVASDEALAQAGWNGEKPYASERIGCILASGIGGLESLEGQHDNLRDRGEKAVSP
LSVPLFMVNAAAAALSMRHGLRGPSFQVGSACAAGSHAIGTAFRTIQMGDADAVVTGGAE
ATLTPLARASFMAASAMSPTGISRPFDARRDGFVMGEGAGVLVIEDREKALERGATILGE
IRGYSTTSDAYHITATHPDGTYAAAAMRGALAEAGVTPEQIDYVNAHGTSTSLNDAAETV
AIKAVFGDAANDVPISSTKSSIGHLLGAAGAVEAIATVLAMNARTIPPTLGLEEPDPDLD
LDYVPLTSRELTPRNGTPIALSNSFGFGGHNVVLCLEGASA
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaagcgacgcgtcgtcatcaccggtgtgggtgccgtgaccccgctcggggtcggtgcc
gagccgctgctgcgacgctgggcggccggcgagagcggcatcgtcgacggggagggcgcc
tgtcgcgactacgtcgcgaaggagcacctctccgtcaaggaggctcgccgcgccgaccgc
ttcgcgcagctcgcgatggtcgcgagcgacgaggcgctggcccaggccggttggaacggg
gagaagccgtacgcctccgagcggatcggctgcatcctcgcctccggcatcggcggcctc
gagtcgctcgagggccagcacgacaacctgcgcgacagaggcgagaaggcggtgtcgccg
ctctccgtcccgctgttcatggtcaacgcggccgccgcggcgctgtcgatgcgccacggg
ctgcgcggcccgtcgttccaggtcggctcggcctgcgcggccgggtcgcacgcgatcggc
accgcattccgcacgatccagatgggcgacgcggacgccgtcgtgaccggcggcgccgag
gcgacgctgacgccgctggcgcgggcgagcttcatggccgcaagcgccatgtcgccgacc
ggcatctcgcgtccattcgacgcgcgccgtgacggcttcgtgatgggcgagggcgcgggc
gtcctcgtgatcgaggaccgcgagaaggcgctggagcgcggcgcgacgatcctcggcgag
atccgcgggtactccaccacctccgacgcgtaccacatcaccgccacgcacccggacggc
acgtacgccgccgccgcgatgcgcggcgcgctggccgaggccggcgtgacgccggagcag
atcgactacgtcaacgcgcacggcacctcgacgtcgctcaacgacgccgccgagaccgtc
gcgatcaaggccgtcttcggcgacgcggccaacgacgtcccgatctcctcgacgaagtcg
tcgatcggccacctgctcggggctgccggcgcggtggaggcgatcgcgaccgtgctcgcg
atgaacgcgcgcacgatcccgccgacgctcgggctggaagagcccgaccctgacctcgat
ctggattacgtcccgctgacgtcgcgtgagctgacgccgcgcaacgggacgccgatcgcc
ctgtcgaactcgttcggcttcggcggtcacaacgttgttctctgcctggaaggagcctcc
gcatga

DBGET integrated database retrieval system