KEGG   Conexibacter woesei: Cwoe_5280Help
Entry
Cwoe_5280         CDS       T01153                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
cwo  Conexibacter woesei
Pathway
cwo00020  Citrate cycle (TCA cycle)
cwo00270  Cysteine and methionine metabolism
cwo00620  Pyruvate metabolism
cwo00630  Glyoxylate and dicarboxylate metabolism
cwo00680  Methane metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
cwo01200  Carbon metabolism
Module
cwo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cwo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cwo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cwoe_5280
   00620 Pyruvate metabolism
    Cwoe_5280
   00630 Glyoxylate and dicarboxylate metabolism
    Cwoe_5280
  Energy metabolism
   00680 Methane metabolism
    Cwoe_5280
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cwoe_5280
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Cwoe_5280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ADB53686
UniProt: D3FF93
LinkDB All DBs
Position
complement(5639479..5640474)
Genome map
AA seq 331 aa AA seqDB search
MTDKQPVRVAVTGAAGQIGYALLFRIASGALLGPDQPVSLRLLEITPALKAVEGVIMELD
DCAFPLLHSVEATDDANVAFDGASVGLLVGARPRSRGMERADLLEANGGIFKPQGQAINA
HAADDIKVLVVGNPANTNALIAASNAPDVPKDRFHAMTRLDHNRAIAQLSKKTGAAVKDI
TNVTIWGNHSATQYPDIFHAKVNGQNAAELVNDQAWLENDFIPTVQKRGAAIIDARGASS
AASAANAAIDHVHDWVLGTPAGDWVSMSVPSDGSYGVPEGIISSFPCTTKPGGEYEIVQG
LEIDAFSRARIDASANELVEERAAIRQLGLI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacaagcaacccgtccgcgtcgccgtcaccggtgccgccggccagatcggctac
gccctgctgttccgcatcgccagcggcgccctgctcggacccgaccagcccgtctcgctg
cggctgctcgagatcacccccgcgctgaaggcggtggagggcgtgatcatggagctggac
gactgcgccttcccgctgctgcacagcgtcgaggcgaccgacgacgcgaacgtcgcgttc
gacggcgcgagcgtcggcctgctcgtcggcgcgcgcccgcgctccagaggcatggagcgc
gcggacctgctggaggccaacggcggcatcttcaagccgcagggccaggcgatcaacgcg
cacgccgcggacgacatcaaggtgctcgtcgtcggcaacccggcgaacaccaacgcgctg
atcgcggcgagcaacgcgcccgacgtgccgaaggaccgcttccacgcgatgacgcggctc
gaccacaaccgcgcgatcgcgcagctgtcgaagaagaccggcgccgcggtgaaggacatc
accaacgtgacgatctggggcaaccactcggcgacccagtaccccgacatcttccacgcg
aaggtgaacgggcagaacgcggctgagctggtgaacgaccaggcgtggctggagaacgac
ttcatcccgacggtgcagaagcgcggcgcggcgatcatcgacgcgcgcggcgcctccagc
gccgcgtcggcggcgaacgcggcgatcgaccacgtccacgactgggtgctcggcacgccg
gccggcgactgggtgtcgatgtcggtcccgtccgacggctcctacggcgtgcccgagggg
atcatctcctcgttcccgtgcacgacgaagcccggcggcgagtacgagatcgtccagggc
ctggagatcgacgccttctcacgcgcgcggatcgacgcgagcgccaacgagctggtcgag
gagcgcgcggcgatcagacagctcggcctgatctag

DBGET integrated database retrieval system