KEGG   Synechococcus sp. JA-3-3Ab: CYA_0955Help
Entry
CYA_0955          CDS       T00318                                 

Definition
(GenBank) glycosyl transferase, group 2
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cya00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cya01003]
    CYA_0955
Enzymes [BR:cya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     CYA_0955
Glycosyltransferases [BR:cya01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   CYA_0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_transf_21 Glyco_trans_2_3 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ABC99157
CyanoBase: CYA_0955
CYORF: CYA_0955
UniProt: Q2JVS4
LinkDB All DBs
Position
968098..969234
Genome map
AA seq 378 aa AA seqDB search
MLALQMPMAAVLLARLLPSLWRPSPLPPGQAGIPFPTGLVSVLLPTLNEAERLDPCLEGL
HRQGAVVREVLVVDSRSQDGTREKVLQMAARDPRFRLVTDDPLPSGWVGRPWALHYGFLQ
SDPASEWILGIDADTRPQPGLVERLLETAQAKKLDLITLAPQFILQHWGEGWLQPALLTT
LIYRYGAAGETPHLPERTMANGQCMLVRRSVLEAMNGYTLARASFCDDVTLVRQIAAAGF
KVAFCDGRHLLKVRMYTSLAETWREWGRSLDLKDATPRAQLWGDMALLVLTQGIPLLAVG
GLGIKAGLGFPFSLTEQVLLGLNLGLLALRLGVLMGIRGSYQDPPWTFWASPLADPLAVL
RVILSALSRPRSWRGRTY
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgttggccctgcagatgccgatggcggcggtgttgctggcgcggctgctgccctctttg
tggcgcccttcccctctgccccctggccaagcggggatccccttcccgacgggcctggtc
agcgtcttgctgcccaccctcaacgaggccgagcgcctggatccctgtctggaagggctg
caccgccagggagcggttgtgcgcgaagttctggtggtggatagccgctcccaggatggc
acccgcgaaaaagtgctgcaaatggccgcgcgggatccccgctttcgcctcgttaccgac
gatcccctgcccagcggctgggtcggtcgcccttgggcgttgcactatggatttctccag
tcggatcccgcctctgagtggatcttgggcattgatgccgacacccgcccccagccgggc
ctggtggagcggctgctggaaactgcccaggccaaaaagctggatctcatcaccctggcg
ccgcagtttatcctgcagcactggggggaaggctggctgcagccagctcttttgacaacc
ctgatctaccgctatggggcggcaggggagactccccacttgccggagcggacgatggcc
aatgggcagtgtatgttggtgcgccgctcggtgctggaagccatgaacggctataccctg
gcgcgggcctccttttgcgacgatgtcaccttggtgcggcagatcgcggcagccggcttt
aaagtagctttttgcgacggtcggcacctgctcaaggtgcgcatgtacacctctttggcc
gaaacttggcgggagtggggccgatccctggatttgaaagacgccacccccagggcccaa
ctgtggggggatatggccctgctggtgcttacccaagggatcccactcttggcagtgggg
gggctggggatcaaggccgggctggggttccccttttccctaacagagcaagtgttgttg
gggctcaacctgggcttgctggccctgcgactgggggtgctgatgggcattcgcggctct
tatcaggatcccccctggacgttttgggcttcgccgctggcggatcccttggctgtcctg
cgggtgatcttgtcagccctcagccgcccccgctcttggcgcgggcgcacctactag

DBGET integrated database retrieval system