KEGG   Synechococcus sp. JA-3-3Ab: CYA_1194Help
Entry
CYA_1194          CDS       T00318                                 

Gene name
cbbL
Definition
(GenBank) ribulose bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00630  Glyoxylate and dicarboxylate metabolism
cya00710  Carbon fixation in photosynthetic organisms
cya01100  Metabolic pathways
cya01120  Microbial metabolism in diverse environments
cya01200  Carbon metabolism
Module
cya_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cya_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cya_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CYA_1194 (cbbL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYA_1194 (cbbL)
Enzymes [BR:cya01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CYA_1194 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABC99380
CyanoBase: CYA_1194
CYORF: CYA_1194
UniProt: Q2JV67
LinkDB All DBs
Position
1207204..1208628
Genome map
AA seq 474 aa AA seqDB search
MAYSATQTKKGYQAGVKDYRLTYYTPDYTPKDTDVLACFRVTPQPGVPPEEAGAAVAAES
STGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEENQYFCFVAYPLDLFEEGSVTNMLTSIV
GNVFGFKALKALRLEDVRIPVAYLKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLS
AKNYGRAVYEALRGGLDFTKDDENINSQPFQRWRDRYLFVMEAVHKAQAETGEIKGHYLN
VTAPTCEEMFKRAEFAKEIGAPIIMHDYLTAGFTANTSLAKWCRDNGILLHIHRAMHAVI
DRQKNHGIHFRVLAKCLRMSGGDHLHAGTVVGKLEGDRAITMGFVDLMRENYVEADRSRG
IFFTQDWASMPGVMPVASGGIHVWHMPALVEIFGDDAVLQFGGGTLGHPWGNAPGATANR
VALEACIQARNEGRDLAREGNEIIREAAKWSPELAAACELWKEIKFEFKPVDTL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtggcctactcagcaacccaaaccaaaaagggctatcaagccggcgtaaaggattaccga
ctcacgtattacacgcccgattacacgcccaaggataccgacgtcttggcctgtttccgg
gttactcctcagccgggcgttccccccgaagaggccggggcggctgtggcggctgaatct
tcgaccggcacctggacaaccgtgtggacggatctgctcaccgacttggatcggtacaag
ggccgctgctacgacatcgagccggtcccgggcgaagagaatcaatacttctgcttcgtc
gcctacccgctggatctgttcgaggaaggctcggtcaccaacatgctcacctcgattgta
ggcaacgtcttcggcttcaaagccttgaaagcgttgcggctggaggatgtgcggatcccg
gtggcctacctgaagaccttccagggccctccccacggcattcaggtggagcgggacaag
ttgaacaagtacggccgtccgctgctgggctgcaccatcaagcccaagctgggcctttcc
gccaaaaactacggacgggccgtgtacgaggcgctgcggggcgggttggacttcaccaaa
gacgacgaaaacatcaactcccagcccttccagcgctggcgggatcgctacctctttgtg
atggaggctgtccacaaggcgcaggcagagactggcgagatcaaggggcactacctgaac
gtgacggcgcccacctgtgaggagatgttcaagcgggcggagtttgccaaggagatcggt
gcccccatcatcatgcacgattacctgactgccggatttaccgccaacaccagcttggcc
aagtggtgccgcgacaacggcatcctgctgcacattcaccgtgccatgcatgccgtgatt
gaccgccagaaaaaccacggcatccacttccgggtgctggccaagtgcttgcgcatgtcc
ggcggcgaccacctgcatgccggtacggtggtgggcaagttggagggcgaccgcgccatc
accatgggctttgtggatctcatgcgggaaaactacgtggaggccgaccgctcccgcggc
attttcttcacccaagattgggcctccatgcctggggtgatgccggtggcctccggtggc
attcacgtctggcacatgccggcgctggtggagatcttcggcgacgacgcggtgctgcag
tttggtggcggaaccctgggacacccctgggggaacgcgccaggcgccactgccaaccgg
gtggccctagaagcctgtatccaggcccgcaatgagggtcgggatctggcccgtgagggc
aacgagatcatccgcgaagcggccaagtggtcgccggaactggcggctgcctgcgagctg
tggaaggagatcaagttcgagttcaagcccgtcgatacgctctag

DBGET integrated database retrieval system