KEGG   Synechococcus sp. JA-3-3Ab: CYA_1682Help
Entry
CYA_1682          CDS       T00318                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00061  Fatty acid biosynthesis
cya00780  Biotin metabolism
cya01100  Metabolic pathways
cya01130  Biosynthesis of antibiotics
cya01212  Fatty acid metabolism
Module
cya_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cya00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CYA_1682
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CYA_1682
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CYA_1682
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cya01004]
    CYA_1682
Enzymes [BR:cya01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CYA_1682
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CYA_1682
Lipid biosynthesis proteins [BR:cya01004]
 Fatty acid synthase
  Component type
   CYA_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ABC99838
CyanoBase: CYA_1682
CYORF: CYA_1682
UniProt: Q2JTZ1
LinkDB All DBs
Position
1682064..1682840
Genome map
AA seq 258 aa AA seqDB search
MLDLTGKKALVTGIANERSIAWGIAQQLHKAGATLGVTYLPDERDRFKTKVQQLTEPLQP
DFLLPCDVQSDQQIDELFQAIAQKWGQVDILVHCLAFVKKEELSGNFSDISREGFALAMD
VSTYSLIALCRAAKPLLRSGSSILTLTYLGGVRVVPNYNMAAVTKAGLETCVRYLAAELG
PAGIRVNAISAGPIRTLASSAIADFHAMLHAVEEKAPLRRNITQLEVGNVAAFLASDLAS
GITGQVIYVDSGYSILGF
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctagacctgaccggaaaaaaagccttggtaaccggcattgccaacgagcgctccatc
gcctggggcattgcccagcaactgcacaaagcgggggcgacgttgggggttacctatctg
ccggacgagcgggatcgcttcaagaccaaagtccagcagctcaccgagcccctgcagccg
gattttctcctcccttgcgacgtgcaaagcgaccagcagattgacgagctgtttcaggca
atagcccagaaatggggtcaggtcgatatcttggttcactgcctggctttcgtcaaaaaa
gaagagctgagcggcaactttagcgatatctcgcgggaagggtttgccctggccatggat
gtgagcacctactccctgattgccctctgccgggccgccaagcctctcttgagatccggc
agcagcatcctcaccctcacctatttggggggggtgcgggtggtgcccaactacaacatg
gccgctgtcaccaaagcgggcctggaaacctgcgttcgctacctggcggccgagctgggc
cccgccgggatccgggtgaatgccatctccgctggacccattcgcaccttggcttcttcg
gccattgctgatttccatgccatgctgcacgcggtcgaggagaaagctccgctgcggcgc
aatatcacccagctcgaggtgggcaatgtggcagcttttctggccagcgacctggccagc
ggcattaccggccaggtgatctatgtggatagtggatatagcatcctgggtttttag

DBGET integrated database retrieval system