KEGG   Synechococcus sp. JA-3-3Ab: CYA_2127Help
Entry
CYA_2127          CDS       T00318                                 

Gene name
glgP
Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00500  Starch and sucrose metabolism
cya01100  Metabolic pathways
cya01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CYA_2127 (glgP)
Enzymes [BR:cya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     CYA_2127 (glgP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ABD00267
CyanoBase: CYA_2127
CYORF: CYA_2127
UniProt: Q2JSU7
LinkDB All DBs
Position
2141368..2143968
Genome map
AA seq 866 aa AA seqDB search
MKPLRTFKVTPYLPAALESLRLLAYNLHFSWNVETRSLFRRMDPDLWDACGHNPVALLGQ
IRQERLDELAEDPGFLAHLERASQQLQSYLQEDTWYRKYRSAQAVEGECYAYFSAEFGLA
DCLPLYSGGLGVLAGDHLKAASDLGLPLVGVGLLYQKGYFRQYLNPDGWQQERYPVNDFF
NMPLELQRDAEGREIRIEVDYPKRKVFARIWKAMVGRVPLYLLDTNIEPNSQYDQDITDE
LYGGDQDVRIHQEIMLGIGGVRALRALGIHPTVYHMNEGHSAFLAVERIRLLMVEQGLSF
EEAWQVAKSSQMFTTHTPVPAGIDLFPPDKIDYYLGFYYSQMGLSRERFLALGRENTGDF
QSPFSMAVLAINMASFVNGVSKLHGSVSRKMFSRLWPEIPLEEVPITSITNGVHARTWVG
EENQALYDRYLGPDWAEAPPSDPLWQKVDRIPDGELWRAHERSRSRLINFVRERLVEQLQ
KRAASAVEIQWASEALNPEVLTIGFARRFATYKRATLLFHNLERLKALLNHPQYPMQFIF
AGKAHPRDNPGKELIRQIVQVSRQPEFRQRLVFIEDYDMYITSLLVAGVDVWLNTPLRPR
EASGTSGMKAAANGGQNLSILDGWWDEADYYQTGWPIGRGEEYEDRAYQDEVESNALYDL
LEQEVAPLFYQRGSDGLPHAWIRRMKQAIQLNCPRFSTQRMVLEYAERAYIPLSNYFDRM
RRDNFESARQFTRWRSHLQENWYNIRVVNVQVEPPKKASAAGLPSAQNDQVVMARDPLTV
TVEVRLGSLQPQDVIVQAYQGPVDDNGQIRNGQATPLRYVETVEDRAIFSGQIRYEASGL
QGLAIRLLPFHPDMHDPYELRLMLWA
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgttacgcacgttcaaggtcactccctacctgccggctgctctggaaagtctg
cgcttgttggcctataacctgcattttagttggaacgtggaaacccgcagcctgtttcgg
cgcatggatccagatctgtgggatgcctgtggccacaatccggtggctttgttggggcag
attcggcaggagcggctggacgagctggcggaggatcctggttttttggcccacctggag
cgggccagccaacagctccagagctacctgcaggaagacacctggtatcgcaagtatcgc
tcggcccaagcggtggaaggggagtgctacgcctatttttcagccgagtttggtctggca
gattgtttgcccctctactcaggaggcctgggggtcttggccggggatcacctcaaggcg
gccagcgacctgggcctgccgctggtgggggtgggcctgctctaccagaaggggtatttt
cgccagtacctcaaccccgacggctggcagcaggagcgctatcccgttaacgattttttc
aatatgcccctggagctgcaaagagatgcggagggccgcgagattcgcatcgaggtggac
taccccaaacgcaaggtgtttgcccgcatttggaaggcgatggtggggcgggtgcccctc
tacctgctggacaccaacatcgagcccaacagccagtacgaccaggacatcaccgatgag
ctgtacggcggcgaccaggatgtgcgcatccaccaggagatcatgttggggatcggcggc
gtgcgggctttgcgcgccctcggcatccatcccaccgtctaccacatgaacgaggggcac
tcggcttttttggcggtggagcgcatccgcctgttgatggtggagcaggggttgagcttt
gaagaagcctggcaggtggccaagtccagccagatgtttaccacccacacgccggtacct
gccgggatcgacctgttcccgcccgacaaaatcgactactacctcggcttctactacagc
cagatgggcctgagccgggagcgctttttggccctgggccgcgaaaacaccggcgacttt
caatcccccttcagcatggcagtgctggccatcaacatggcctcgtttgtcaacggcgtc
agcaagctgcacgggtcggtctcgcgcaagatgttcagccgcctctggcccgagatcccg
ctggaagaagtgccgattacttccatcaccaacggggtgcatgcccgcacctgggtgggg
gaagagaaccaggccctctacgatcgctacctggggccggattgggcggaggctcccccc
tcggatcccctgtggcagaaagtggatcggatcccggatggggagctgtggcgggcccac
gagcgcagccgctcgcgcctgatcaacttcgttcgcgagcgcctggtggagcaactgcaa
aagcgggcggcctcagcggtggaaattcagtgggcctctgaagccctcaacccggaagtg
ctcaccattggctttgcccgccgctttgccacctacaagcgggccaccctcttgtttcac
aacctggaacggctcaaagccttgctcaaccatccccagtacccgatgcagtttatcttt
gccggcaaggcccaccctcgcgacaaccccggcaaggagctgatccggcaaattgtgcaa
gtgtcgcgccagccggagtttcgccagcggctggtgtttatcgaagactacgacatgtac
atcaccagcctgctggtagccggggtggatgtgtggctaaacacccccctgcgcccccgc
gaggccagcggcaccagtggcatgaaggcggcggccaacggcggacagaacctgagcatt
ttggatggctggtgggatgaggccgattactaccagaccggctggcccattggccgcggc
gaggaatacgaggatcgcgcctaccaagacgaggtggagtccaacgccctctacgacctg
ctggaacaggaggttgcccctctgttttaccagcgcggtagcgatggcctgccccacgcc
tggattcggcgcatgaagcaggccattcagctcaactgcccccgctttagcacccagcgc
atggtactggagtatgccgagcgggcctacattcccctcagcaactacttcgaccgcatg
cgccgcgataacttcgagtcggctcgccagtttacccgctggcgcagccatctgcaggag
aactggtacaacattcgggttgtcaatgtccaggtcgaaccccccaagaaagcttccgcc
gccggcctcccctcggcgcaaaacgaccaagtggtgatggcccgcgatcccctcacggtg
accgttgaggtgcggctgggatccctgcaaccccaggatgtcatcgtccaggcctaccag
gggccggtggacgacaacggccagatccggaacggccaagcaacccccctgcgctacgtg
gagacggtggaggatcgggccatcttctccggccagattcgctacgaggccagcggcttg
caggggctggccatccgcctgctgccctttcatcctgacatgcacgatccctatgagctg
cggctgatgctctgggcctag

DBGET integrated database retrieval system