KEGG   Synechococcus sp. JA-3-3Ab: CYA_2146Help
Entry
CYA_2146          CDS       T00318                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
cya  Synechococcus sp. JA-3-3Ab
Brite
KEGG Orthology (KO) [BR:cya00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cya01001]
    CYA_2146
Enzymes [BR:cya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CYA_2146
Protein kinases [BR:cya01001]
 Serine/threonine kinases: Other
  Bacterial family
   CYA_2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo
Motif
Other DBs
NCBI-ProteinID: ABD00286
CyanoBase: CYA_2146
CYORF: CYA_2146
UniProt: Q2JQG2
LinkDB All DBs
Position
2158113..2160044
Genome map
AA seq 643 aa AA seqDB search
MDSPGAVSRRTRTTKSIHDSYQILGLAGQGQYGRVFCARPRHGGDLVALKELPAERFPTP
NLLRELRYLLTLNHPNITRCYALEHAREGRYLVLEYCEGGTLRELIDQVERGLWLPVKQV
LGFVDQILAGLDHAHRQGVIHCDVKPENILLKPTPQGWQLKLTDFGIARHPQPAPGEISA
TGSPAYMAPERFYGQFSPASDLYAVGIILLELLTGRRPFSGSPSQLMHAHLNQPFVCPEG
IPAPLQELLEITLRKLPLRRFRTAAQMRSALATFAREWQEPAGCWVGPRLSRRSPPGLQV
WDLPDPGFVGEGGRESLPEQKFCICEDPSGSRSPLLLRVTPQRLEWLDLQTLASGAPPLA
CFSLAEPLQQVLPLPSFPEALAFSKSNLLHLSPARVRTLLSFAEDWRATWLAERQELVWA
TAKEIGAVQWLPAGPTVAQPFPEFHCYFRWPWQVPTGSLLRLLALSEHLVLLAGLGRQWV
EMTVLPYPAAWPPQTGSQPLRYRLPLDPRGRVLSLGERLLFAGGDGGGQGCCPHLCSVQV
NPLRLRRWFLKGWPLQMAKAPWGVLLLCREGEEFSSLWLYSEGGYPLAQVAVPVGSEVLQ
VGQRGLVWLQVPKAGKPQQFQLWQLDLNQLPANGHAAEGVALG
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggattcccctggggccgtgtcccgacgcacccgtaccaccaagtcgattcacgacagc
taccaaattttgggtttggccggccaagggcagtatgggcgcgtgttctgtgcccggccc
cgccacgggggggatctggtggccctcaaggagctgccggcagagcgctttcccaccccc
aacctgctgcgggagctgcgctacctgctgacattgaaccaccccaacatcacccgctgc
tacgccctcgaacatgcccgtgaggggcgctatttggtgttggagtactgcgaagggggc
acgctgcgggagctgatcgaccaggtggagcgggggctgtggctgccggtcaagcaggtt
ttgggctttgtggatcagatcttggccggcttggatcatgcccatcgacagggggtaatc
cactgcgatgtcaagccagagaatatcttgctcaagcccacgccccagggttggcaactg
aagctgacggactttggcatcgctcgtcacccccagcctgctcccggcgagatctctgcc
accggctcccccgcctacatggcgccagagcggttctacggccagttcagccccgcttct
gacctctacgcggtggggatcatcctcctggagctgttgacgggccggcgacccttttcc
ggctcccccagccagttgatgcacgcccacctcaaccagccgtttgtctgtccggaaggg
atcccggccccgctgcaggaactgctggagatcacgttgcgcaagttgcccctgcggcgg
tttcgcaccgcggcccagatgcgttcggccctggcaacctttgcccgggagtggcaggag
ccagccggttgttgggtcggccctcgcctgtccaggcggtcacctcccggcctgcaggtc
tgggatctgccggatccgggttttgttggcgagggcgggagggagtccctgcctgagcaa
aagttctgcatctgtgaagatccgagcggctcccgatccccgctgctgctgcgggtaacc
cctcagcggctggagtggctggatctgcagacccttgcctcaggagcgccgcctctggcc
tgtttctccttggccgaaccgttgcagcaagtgctgcccttgccgagcttcccggaggct
ttggctttttccaaaagcaaccttttgcacctgagtcccgcgcgcgtccgtaccttgctg
agttttgcggaggattggcgagccacctggctggcggagcggcaggagttggtctgggcc
actgccaaagaaattggggcagtgcaatggctgccggctgggccaaccgtagctcaacct
tttccggagttccactgctactttcgctggccttggcaggtgccaacgggatccctgctc
cgcttgctggctctctcggagcatctggtgctgttggcgggattggggcggcagtgggtg
gaaatgactgtgttgccctatccggcggcctggcctccgcagacgggctcccagccgctg
cgctatcgcctacccctggatcccagggggagagtgctcagcttgggggagcggctgctt
tttgccggcggggatggaggaggccagggatgctgcccccacctttgctcggtgcaggtc
aacccgctgcggctgcgccgctggtttttgaaggggtggcccctgcaaatggccaaggcc
ccttggggcgtgctgctcctgtgtcgcgagggggaggagttctcttccctctggctgtat
agcgagggggggtatcccttggcccaggtggccgtgcccgtcggatccgaggtgttgcag
gtggggcaaaggggactggtctggctgcaagtgcccaaggccgggaagccgcagcaattt
cagctttggcagttggatctcaaccagttgccggcgaatggccatgccgccgagggggtt
gctttgggctag

DBGET integrated database retrieval system