KEGG   Synechococcus sp. JA-3-3Ab: CYA_2858Help
Entry
CYA_2858          CDS       T00318                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cya  Synechococcus sp. JA-3-3Ab
Brite
Enzymes [BR:cya01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CYA_2858 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABD00958
CyanoBase: CYA_2858
CYORF: CYA_2858
UniProt: Q2JR14
LinkDB All DBs
Position
2874084..2874683
Genome map
AA seq 199 aa AA seqDB search
MAFELPALPYPADALKPYMSAETFSYHHGKHHAAYVANLNKLIEGTELANKSLEEIIKTT
FGDPDKVGIFNNAAQVWNHTFFWESMKPGGGGAPTGPIADKINADFGGYDKFVEAFKTAA
ATQFGSGWAWLVLDNGTLKVTKTPNAENPLVHGQVPLLTLDVWEHAYYLDYQNRRPDFIS
AYLEHLVNWDAANARLAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaactcccggctctgccctaccctgccgacgccctcaagccctatatgtcg
gcggaaaccttctcctaccaccacggcaagcaccacgccgcctacgtggccaacctaaac
aagctgatcgaaggcaccgagctggccaataagtcgctagaagaaattatcaagaccacg
tttggggatcccgacaaagtgggcatcttcaacaatgccgcccaggtctggaaccacacc
tttttctgggaatccatgaagccaggtgggggcggcgcgccgacggggcccatcgccgac
aagatcaacgccgattttggcggctacgacaagtttgtcgaggccttcaaaacggcggcg
gccacccagtttggcagcggctgggcctggctggtgctggacaacggcaccctcaaggtt
accaaaacccccaacgccgaaaacccgctggtgcacggccaagtgcccctgctcactttg
gatgtctgggagcacgcctactacctggactaccaaaaccggcggcccgacttcatcagc
gcctacctggagcacctagtgaactgggatgccgccaatgcccggctggctgctgcctga

DBGET integrated database retrieval system