KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1116
Entry
CYB_1116          CDS       T00319                                 

Definition
(GenBank) 2-oxo acid dehydrogenase, acyltransferase, putative
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00010  Glycolysis / Gluconeogenesis
cyb00020  Citrate cycle (TCA cycle)
cyb00620  Pyruvate metabolism
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
cyb01120  Microbial metabolism in diverse environments
cyb01200  Carbon metabolism
Module
cyb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYB_1116
   00020 Citrate cycle (TCA cycle)
    CYB_1116
   00620 Pyruvate metabolism
    CYB_1116
Enzymes [BR:cyb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CYB_1116
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL
Other DBs
NCBI-ProteinID: ABD02093
CyanoBase: CYB_1116
CYORF: CYB_1116
UniProt: Q2JME8
LinkDB
Position
1153962..1155236
AA seq 424 aa
MIHELSMPALSSTMETGKIVTWLKNPGDRVEKGENILVVESDKADMDVESFHSGILASIL
VPAGESAPVGAPIALIAESEAEVAQAQEKAKALAAGVTPAAPPSADRASAAQPTSPAPAA
TPTSTLPNGSDGAGSQRIVASPRAKKLAESLGIDLRTVRGSGPNGRIIAEDVERAAALSA
PAVAAPSAPAPAPPTPVAVPLGETVPLSTLQAAVVRNMNASLGVPVFHVGYTITTDSLDH
LYQQVKPKGVTLTALLVKAVAMTLEKHPLLNASYTEGGIHYKSDINIAVAVAMEDGGLIT
PVLKQANRLDLYEISRRWKDLVERARRKQLQPEEYNSGTFTLSNLGMFGVDRFDAILPPN
QGSILAIGASRPTVVATPEKAIAIRSQMQVNLTCDHRVIYGAHAAAFLQDLAQLIEHKVG
SLTL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgatccacgaactctccatgccggccctcagctccaccatggaaacgggcaagatcgtc
acctggctgaaaaaccccggcgaccgcgtggagaaaggagaaaacatcctggtggtggag
tccgacaaagcggacatggacgtggagtccttccacagcggcatcctggccagtatcctg
gtgccggcaggggaatcagccccggtgggcgcccccattgccctgattgccgaaagcgaa
gcggaagtggcccaagctcaggaaaaagccaaagccctcgctgctggcgttacccctgcg
gctccacctagcgcagaccgcgcctctgcagctcagccgacaagtcctgcccctgcggca
acccccacctctacactgccaaatggatcggatggcgccggatcccagcggatcgtggct
tccccgcgggcgaaaaaattggcggaaagcctggggatcgatctgcgcaccgtgcgcggc
tccggccccaacggtcgcatcatagccgaagacgtggagcgagctgcggccctttccgct
cctgcagtggctgccccctctgctccagcccccgcgcctccaactcctgtagctgtcccc
ttgggagaaacggttcccctcagcactttacaagcggcggtggtgcgcaacatgaacgcc
agccttggcgtgccggtgttccacgtgggctacaccatcaccaccgatagcctggatcac
ctctaccaacaggtaaagcctaagggggtgaccctgacggccctcttggtcaaagccgtg
gccatgaccctggagaagcatccccttttgaatgccagctacacagaaggcgggatccat
tacaaatcggatatcaacatcgccgtggccgtggccatggaggatggcgggctgatcacc
cctgtcctaaagcaagccaaccggctcgatctgtacgagatctcccgccgctggaaggat
ctggtggagcgggcgcggcgcaagcaactgcagccggaagagtacaatagcggcaccttc
accctctccaacctgggcatgttcggggtggatcgcttcgatgccattttgccccccaac
cagggatccattttggccatcggcgcttctcgccccacggtggtggcgacgccggaaaaa
gccattgccatccgttcccaaatgcaggtgaacctcacctgtgatcaccgtgtcatctac
ggcgcccatgcagcggctttcctgcaggatctggcgcagctcatagagcacaaggtggga
tccctgacgttgtag

DBGET integrated database retrieval system