KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1116Help
Entry
CYB_1116          CDS       T00319                                 

Definition
(GenBank) 2-oxo acid dehydrogenase, acyltransferase, putative
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00010  Glycolysis / Gluconeogenesis
cyb00020  Citrate cycle (TCA cycle)
cyb00620  Pyruvate metabolism
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
cyb01120  Microbial metabolism in diverse environments
cyb01130  Biosynthesis of antibiotics
cyb01200  Carbon metabolism
Module
cyb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYB_1116
   00020 Citrate cycle (TCA cycle)
    CYB_1116
   00620 Pyruvate metabolism
    CYB_1116
Enzymes [BR:cyb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CYB_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL
Motif
Other DBs
NCBI-ProteinID: ABD02093
CyanoBase: CYB_1116
CYORF: CYB_1116
UniProt: Q2JME8
LinkDB All DBs
Position
1153962..1155236
Genome map
AA seq 424 aa AA seqDB search
MIHELSMPALSSTMETGKIVTWLKNPGDRVEKGENILVVESDKADMDVESFHSGILASIL
VPAGESAPVGAPIALIAESEAEVAQAQEKAKALAAGVTPAAPPSADRASAAQPTSPAPAA
TPTSTLPNGSDGAGSQRIVASPRAKKLAESLGIDLRTVRGSGPNGRIIAEDVERAAALSA
PAVAAPSAPAPAPPTPVAVPLGETVPLSTLQAAVVRNMNASLGVPVFHVGYTITTDSLDH
LYQQVKPKGVTLTALLVKAVAMTLEKHPLLNASYTEGGIHYKSDINIAVAVAMEDGGLIT
PVLKQANRLDLYEISRRWKDLVERARRKQLQPEEYNSGTFTLSNLGMFGVDRFDAILPPN
QGSILAIGASRPTVVATPEKAIAIRSQMQVNLTCDHRVIYGAHAAAFLQDLAQLIEHKVG
SLTL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaactctccatgccggccctcagctccaccatggaaacgggcaagatcgtc
acctggctgaaaaaccccggcgaccgcgtggagaaaggagaaaacatcctggtggtggag
tccgacaaagcggacatggacgtggagtccttccacagcggcatcctggccagtatcctg
gtgccggcaggggaatcagccccggtgggcgcccccattgccctgattgccgaaagcgaa
gcggaagtggcccaagctcaggaaaaagccaaagccctcgctgctggcgttacccctgcg
gctccacctagcgcagaccgcgcctctgcagctcagccgacaagtcctgcccctgcggca
acccccacctctacactgccaaatggatcggatggcgccggatcccagcggatcgtggct
tccccgcgggcgaaaaaattggcggaaagcctggggatcgatctgcgcaccgtgcgcggc
tccggccccaacggtcgcatcatagccgaagacgtggagcgagctgcggccctttccgct
cctgcagtggctgccccctctgctccagcccccgcgcctccaactcctgtagctgtcccc
ttgggagaaacggttcccctcagcactttacaagcggcggtggtgcgcaacatgaacgcc
agccttggcgtgccggtgttccacgtgggctacaccatcaccaccgatagcctggatcac
ctctaccaacaggtaaagcctaagggggtgaccctgacggccctcttggtcaaagccgtg
gccatgaccctggagaagcatccccttttgaatgccagctacacagaaggcgggatccat
tacaaatcggatatcaacatcgccgtggccgtggccatggaggatggcgggctgatcacc
cctgtcctaaagcaagccaaccggctcgatctgtacgagatctcccgccgctggaaggat
ctggtggagcgggcgcggcgcaagcaactgcagccggaagagtacaatagcggcaccttc
accctctccaacctgggcatgttcggggtggatcgcttcgatgccattttgccccccaac
cagggatccattttggccatcggcgcttctcgccccacggtggtggcgacgccggaaaaa
gccattgccatccgttcccaaatgcaggtgaacctcacctgtgatcaccgtgtcatctac
ggcgcccatgcagcggctttcctgcaggatctggcgcagctcatagagcacaaggtggga
tccctgacgttgtag

DBGET integrated database retrieval system