KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_1912Help
Entry
CYB_1912          CDS       T00319                                 

Gene name
pstB-2
Definition
(GenBank) phosphate ABC transporter, ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cyb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CYB_1912 (pstB-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyb02000]
    CYB_1912 (pstB-2)
Enzymes [BR:cyb01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     CYB_1912 (pstB-2)
Transporters [BR:cyb02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    CYB_1912 (pstB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 RsgA_GTPase AAA_16 AAA_22 AAA_29 AAA_15 NB-ARC Rad17 QSOX_Trx1 AAA_25
Motif
Other DBs
NCBI-ProteinID: ABD02867
CyanoBase: CYB_1912
CYORF: CYB_1912
UniProt: Q2JKC2
LinkDB All DBs
Position
complement(1997240..1998037)
Genome map
AA seq 265 aa AA seqDB search
MQTQSLNQTSYVFRTENLNVYYGSNLAVKNVTLDIPARQITAFIGPSGCGKSTILRCFNR
TNDLIPGARVEGKLTYHGKDLYAKEVDPVAVRRRIGMVFQRPNPFPKSIYDNVAYGPRVL
GMKVDLDEVVETSLKRAALWDEVKDKLKENGQSLSGGQQQRLCIARALAVQPDVILMDEP
CSALDPISTRRIEELMKELEEEYTIIIVTHNMQQASRVSDMTAFFSVELVGSNRVGELIE
FDRTEVIFNSPTKQATRDYVEGRFG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactcaatctcttaaccagacctcttacgttttcaggaccgagaacctgaatgtc
tactatggctccaatctggcggtaaaaaatgttactctggacatcccagcccgacagatt
actgcgtttatcggcccttccggctgtggcaaaagcacgatcctacgttgcttcaaccgc
accaacgatttgatccccggtgctcgtgtagagggcaagctcacctaccacggcaaggat
ctctacgccaaagaggtcgatccggtggcggtgcggcggcgtatcggcatggtcttccaa
agacccaatcccttccccaaaagcatttacgacaacgtggcctacggcccgcgggtgctg
gggatgaaggtagacttggacgaggtggtggaaacctcgctgaaacgggctgccctctgg
gatgaagtcaaagacaagttgaaagaaaatggtcagtcgctgtcgggagggcagcagcag
cgcttgtgtattgcccgcgctctggcggtacagccggatgtgattttgatggatgagccc
tgttcggcactggatcccatttccacccgccgtatcgaagagctgatgaaggagctggag
gaggaatataccatcatcatcgtcacccacaacatgcagcaggccagccgcgtctcggat
atgacggctttcttcagcgtggagctggtgggatccaaccgtgtgggcgagctgattgaa
tttgacagaactgaagtcatcttcaacagccccaccaagcaagccacaagagattatgtg
gagggccgcttcggctaa

DBGET integrated database retrieval system