KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2514Help
Entry
CYB_2514          CDS       T00319                                 

Gene name
sodB
Definition
(GenBank) Fe-superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Brite
Enzymes [BR:cyb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CYB_2514 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABD03447
CyanoBase: CYB_2514
CYORF: CYB_2514
UniProt: Q2JIU7
LinkDB All DBs
Position
2608752..2609351
Genome map
AA seq 199 aa AA seqDB search
MAFELPALPYPADALKPYMSAETFSFHHGKHHAAYVANLNKLIEGTDLANKSLEEIIKAT
FGDPDKVGIFNNAAQVWNHTFFWESMKPGGGGAPTGPIADKINADFGSYDKFVEAFKTAA
ATQFGSGWAWLVLEDGTLKVTKTPNAENPLVHGQTPLLTLDVWEHAYYLDYQNRRPDFIN
AYLEHLVNWDAANARLAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaactcccggctctgccctatcctgccgacgcgctgaagccctacatgtcg
gcagaaacgttttccttccaccacggcaagcaccacgcggcctacgtagccaacctgaac
aagctcatcgagggcaccgatctggccaacaagtctctggaggagatcatcaaagccacc
tttggggatcctgacaaagtgggtatcttcaacaatgccgcccaagtttggaaccacacc
tttttctgggaatccatgaagccgggcgggggaggtgcgcctaccgggcctatcgccgac
aagatcaacgccgatttcggcagctacgacaagtttgtcgaggctttcaagacggcggct
gccacccagtttggcagtggttgggcttggctggtgctggaggatggcacgctgaaggtt
accaaaacccccaatgccgaaaatccgctggttcacggtcaaacgcccctgctcaccttg
gatgtgtgggagcacgcctactacctggattaccaaaaccggcggcctgacttcatcaat
gcctacctggagcacttggtgaactgggatgccgccaatgcccggctggctgccgcctga

DBGET integrated database retrieval system