KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2577Help
Entry
CYB_2577          CDS       T00319                                 

Gene name
cbbS
Definition
(GenBank) ribulose bisphosphate carboxylase, small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00630  Glyoxylate and dicarboxylate metabolism
cyb00710  Carbon fixation in photosynthetic organisms
cyb01100  Metabolic pathways
cyb01120  Microbial metabolism in diverse environments
cyb01200  Carbon metabolism
Module
cyb_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cyb_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cyb_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CYB_2577 (cbbS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYB_2577 (cbbS)
Enzymes [BR:cyb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CYB_2577 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABD03509
CyanoBase: CYB_2577
CYORF: CYB_2577
UniProt: Q2JIP5
LinkDB All DBs
Position
complement(2681523..2681855)
Genome map
AA seq 110 aa AA seqDB search
MQTLPKERRYETLSYLPPLTDLQIIKQVQYILDQGYIPAIEFNESSEPTVRYWTLWKLPL
FSATSPQEVLSEVQACRSAYPNCFIRVVGFDNIKQCQVLSFLVYKPSGLR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccttaccaaaagagcgccgctacgaaaccctctcctatctgccgccgctgacg
gatctgcagatcatcaagcaggtgcagtacatcttggatcagggctacatcccggccata
gagttcaacgaatcgtctgaaccaacggttcgctattggacgctgtggaagctgcccctg
ttcagcgccacttctccccaggaggtgctcagcgaagtgcaggcttgccgcagcgcctac
cccaactgtttcattcgcgtggtggggttcgacaacattaagcagtgccaggtgctcagc
ttcctggtctacaagcccagcggcctgcgctga

DBGET integrated database retrieval system