KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_2688Help
Entry
CYB_2688          CDS       T00319                                 

Gene name
glgP
Definition
(GenBank) alpha-glucan phosphorylases
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00500  Starch and sucrose metabolism
cyb01100  Metabolic pathways
cyb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CYB_2688 (glgP)
Enzymes [BR:cyb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     CYB_2688 (glgP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ABD03614
CyanoBase: CYB_2688
CYORF: CYB_2688
UniProt: Q2JIE5
LinkDB All DBs
Position
2772843..2775443
Genome map
AA seq 866 aa AA seqDB search
MKPLRTFKVTPYLPTPLESLRLLAYNLHFSWNVETRSLFRRMDPDLWDACSHNPVALLGR
IRQERLDELAEDPGFLAQLERASQQLQSYLQEDTWYRKYRSAQAVEGECYAYFSAEFGLA
DCLPLYSGGLGVLAGDHLKAASDLGLPLVGVGLLYQKGYFRQYLNPDGWQQERYPVNDFF
NMPLELQRDAEGREIRIEVDYPNRKVFARIWKVTVGRVPLYLLDTNIEPNSQYDQDITDE
LYGGDQDLRIHQEIMLGIGGVRALRALGIHPTVYHMNEGHSAFLAVERIRLLMVEQGLSF
EEAWQVAKSSQMFTTHTPVPAGIDLFPPDKIDYYLGFYYSQMGLSRERFLALGRENTGDF
QSPFSMAVLAINMASFVNGVSKLHGAVSRKMFSRLWPGIPLEEVPITSITNGVHVRTWVG
EENQALYDRYLGPDWAEAPPSDPLWQKVDRIPDGELWRAHERSRSRLINFTRERLMEQLQ
KRAASAAEIQRASEALNPEVLTIGFARRFATYKRATLLFHNLERLKALLNHPQYPMQFIF
AGKAHPRDIPGKELIRQIVQVSRQPEFRQRLVFIEDYDMYVTSLMVAGVDVWLNNPLRPR
EASGTSGMKAAANGGQNLSILDGWWDEADYYQTGWPIGRGEEYEDRAYQDEVESNALYDL
LEQEVAPLFYQRGSDGLPHQWIQRMKQAIRLNCPQFSTQRMVLEYVQRAYIPLSNYFDRM
RRDHFESARQFVRWQNHLQEHWYNIQVLNVQIETPKKAAAAGLALAQDDQVVMARDPLTV
TVEVRLGSLQPQDVIVQAYQGPVKDDGQIQKGQAISLRYVETLEDRAIFSGQICYEASGL
QGLAIRLLPFHPDMHDPYELRLMLWA
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgctacgcacgtttaaggtcactccctacctgcctactccgctggaaagtctg
cgcttgttggcttacaacctgcattttagttggaacgtagaaacccgcagcctattccgg
cgcatggatccggatctgtgggatgcctgcagccacaacccggtggctcttctgggccgg
attcggcaggaacggctggatgagttggcggaggatcccggctttttggcccagttggaa
cgggccagccaacaactgcagagctacctgcaggaagacacttggtaccgcaagtatcgt
tcggcccaagcggtggaaggggagtgctacgcttatttttcggccgagtttggtttggcc
gattgtctgcccctctactcaggcggcttgggggttttggccggggatcacctcaaggcg
gccagcgacctgggcttgcccctggtgggtgtgggcttgctctaccaaaaggggtatttc
cgccagtacctcaaccccgacggctggcagcaggaacgctacccagttaacgatttcttt
aacatgcccctggagctgcagagagatgcggagggccgcgaaattcgcattgaggtggat
tatcccaaccgcaaggtgttcgcccgcatttggaaggtgacggtggggagggtgcccctc
tatcttctggacaccaacatcgagcccaacagccagtacgaccaagacatcaccgatgag
ctgtacggtggcgaccaagatctgcgcatccaccaggagatcatgctggggatcggcggc
gtgcgggctttgcgcgcccttggcatccatcccaccgtctaccacatgaacgaagggcac
tccgcctttttggcagtagagcggattcgcctgttgatggtggagcaggggctgagcttt
gaagaggcctggcaggtggccaagtccagccagatgtttaccacccacacgccggtgccc
gccgggattgacttgttcccgcccgacaagatcgattactacctcggcttctactacagc
cagatgggcctgagccgggagcgctttttggctttgggacgggaaaataccggcgacttc
caatctcccttcagcatggcagtgctggccatcaacatggcctcttttgtgaacggtgtg
agcaagctgcatggggcggtttcccgcaagatgttcagccggctgtggcctgggatcccg
ctggaagaagtgccgattacttccatcaccaacggggtacatgtccgcacctgggtgggg
gaggagaaccaagccctctacgaccgctacctggggccggattgggcagaggctcctcct
tcggatcccctctggcaaaaggtggatcggattccggatggggaattgtggcgggcccac
gagcgcagccgctcccgcctgattaactttacccgcgagcgcttgatggaacagctccag
aaacgggctgcctcagcggctgagatccaacgggcctctgaggccctcaacccggaggtg
cttaccattgggtttgcccgccgctttgccacctacaagcgggccacccttttgttccac
aacctggaacggctcaaggctttgctcaaccatcctcagtacccgatgcagtttatcttt
gccggcaaggcccacccccgcgacatacccggcaaagagctgatccgccagatcgtgcag
gtgtcgcggcagccggagtttcgccagcgcttggttttcattgaggactacgacatgtat
gtcaccagcttgatggtggccggggtggatgtgtggctgaacaaccccttgcgcccccgg
gaggccagcggcaccagtggcatgaaggcggcagccaacggtggacagaacctcagtatt
ttggacggctggtgggacgaggctgactattaccagaccggctggcccattggccgcggt
gaggagtatgaggatcgcgcctatcaagatgaggtggagtcgaatgccctctacgacctg
ctggaacaagaggttgcccctctcttctaccagcgcggcagcgatggcctaccccatcag
tggatccagcgcatgaagcaggcgattcgcctcaattgcccccagttcagcacgcagcgc
atggtgttggagtacgtccagcgagcctacattcctctcagcaactacttcgaccgcatg
cgccgtgaccacttcgagtcggcccgccagttcgttcgttggcaaaaccacctgcaggag
cattggtacaacatccaggttctcaacgtccagatcgaaaccccgaagaaagctgccgct
gccggccttgccttggcacaggatgaccaagtggtgatggccagggatcccctcaccgtg
acggtggaagtgcggctgggatccctgcaacctcaggatgtgattgtgcaagcttatcag
gggccggtcaaggatgatggccagattcagaaaggacaggcaatctccctgcgctatgtg
gagacgctggaggatcgggccatcttttccggccagatttgctatgaggccagcggcttg
caagggttagccatccgcttgctgccctttcaccccgatatgcacgatccctatgagctg
cggttgatgctctgggcgtga

DBGET integrated database retrieval system