KEGG   Cyanothece sp. PCC 7424: PCC7424_0104Help
Entry
PCC7424_0104      CDS       T00808                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00473  D-Alanine metabolism
cyc00550  Peptidoglycan biosynthesis
cyc01100  Metabolic pathways
cyc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cyc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PCC7424_0104
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PCC7424_0104
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PCC7424_0104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cyc01011]
    PCC7424_0104
Enzymes [BR:cyc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PCC7424_0104
Peptidoglycan biosynthesis and degradation proteins [BR:cyc01011]
 Precursor biosynthesis
  Amino acid ligase
   PCC7424_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACK68574
UniProt: B7K991
LinkDB All DBs
Position
complement(117667..118725)
Genome map
AA seq 352 aa AA seqDB search
MTKLRVGLLFGGRSGEHEVSINSAKAIATALSASENATKYDILPVYIRKDGCWQAPDVAQ
QVLESAQPLSTPTDKSPQLWQFPPQVNQVDVWFPILHGPNGEDGTLQGLLTLMQVPYVGS
GVLGSAVGMDKITMKTVFAKAGLPQVKYMTLSRGQIWSNPCIFPKLCDEIEETLNYPCFV
KPANLGSSVGIAKVRSRSELEKALDQAASYDRRIIVEAGVIAREVECAVLGNDNPKASVV
GEITFNSDFYDYETKYTDGRAQLLIPASVPDSIMTQIQEMSLAAFAAVDAAGLARVDFFY
VEKTGEILINEINTLPGFTAFSMYPQLWAATGISFPQLVDRLIELALERHQR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattgagggttggattactatttggcggacgatcgggggaacatgaagtttct
attaattcagcaaaagccattgcaacagcattgtctgcttcagaaaatgccacaaaatat
gatattttacccgtatatatcagaaaagatggctgttggcaagctccagatgtggcacaa
caagttttagagtccgcacaacccctctctacaccaacagataagtctcctcaactttgg
caatttcccccgcaagtaaatcaggttgatgtgtggtttcccattttgcatggccccaat
ggagaagacggaacgttacaagggttactaactttaatgcaagttccctatgtggggagc
ggcgttttaggatcggcggtgggaatggataaaattaccatgaagacggtttttgctaag
gccggtttacctcaagttaagtatatgaccctttctcgcggtcaaatttggtctaatcct
tgtatttttccgaaactgtgtgacgaaattgaagaaactctcaattatccctgttttgtc
aagccggctaatttgggttcatccgttggtattgctaaagtgcgatcgcgttcggagtta
gaaaaagccctcgatcaagccgccagttatgatagacggatcattgtcgaagctggagta
atcgctagagaggtagaatgtgcggttttaggtaatgataatcctaaagcgtcagtggtg
ggagaaattacctttaatagtgatttttatgactatgaaactaaatatactgatggacgc
gcccaattgttaattcctgcttctgtccctgattctatcatgactcaaattcaagaaatg
tctttagctgcctttgctgcggtagatgcggcagggttagcgcgagtggacttcttttat
gtggagaaaacgggggaaatattgatcaatgaaattaacactttacctgggtttactgct
tttagtatgtatccccaactttgggcggcaaccggcatctcttttcctcaattagtcgat
cgcttaattgagttagctttggaacgtcatcaacgttaa

DBGET integrated database retrieval system