KEGG   Cyanothece sp. PCC 7424: PCC7424_0165Help
Entry
PCC7424_0165      CDS       T00808                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00010  Glycolysis / Gluconeogenesis
cyc00053  Ascorbate and aldarate metabolism
cyc00071  Fatty acid degradation
cyc00280  Valine, leucine and isoleucine degradation
cyc00310  Lysine degradation
cyc00330  Arginine and proline metabolism
cyc00340  Histidine metabolism
cyc00380  Tryptophan metabolism
cyc00410  beta-Alanine metabolism
cyc00561  Glycerolipid metabolism
cyc00620  Pyruvate metabolism
cyc00625  Chloroalkane and chloroalkene degradation
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01120  Microbial metabolism in diverse environments
cyc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_0165
   00053 Ascorbate and aldarate metabolism
    PCC7424_0165
   00620 Pyruvate metabolism
    PCC7424_0165
  Lipid metabolism
   00071 Fatty acid degradation
    PCC7424_0165
   00561 Glycerolipid metabolism
    PCC7424_0165
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PCC7424_0165
   00310 Lysine degradation
    PCC7424_0165
   00330 Arginine and proline metabolism
    PCC7424_0165
   00340 Histidine metabolism
    PCC7424_0165
   00380 Tryptophan metabolism
    PCC7424_0165
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PCC7424_0165
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PCC7424_0165
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PCC7424_0165
Enzymes [BR:cyc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PCC7424_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC NYD-SP28 Methyltransf_22
Motif
Other DBs
NCBI-ProteinID: ACK68635
UniProt: B7K9F2
LinkDB All DBs
Position
182559..183938
Genome map
AA seq 459 aa AA seqDB search
MLTLTPIKDLIGQQRDYLATGNSKKIEFRINQLKKLKQAVIDHKQAVIDALKADLNKPEF
EAYFEIIGVNEEIDYAIKNLKSWVKPKSVKTPLTQFPASAKIYPEPLGVVLIIGPWNYPF
SLILTPLVGAIAAGNCAILKPSELAPHTSGVVAQLIKNTFDPAYINVVEGGIETSQQLLG
EKFDHIFFTGGTKVGKIIMEAAAKHLTPVTLELGGKSPCIVDSNINLSETAKRITWGKFI
NSGQTCIAPDYLLVQKSIKNQLVEHIKQQIQEFYGDDPQKSPDYARIINERQFERLKGLL
ADGKIIVGGQTEATTRYIAPTVIEVVSLDSPVMEEEIFGPILPIIEYEQINEAIAIINRR
SKPLALYLFSNDKTKQQQVLEQTSSGGVCLNDTVLQVGVIDLPFGGVGDSGIGNYHGLAS
FKTFSHYKSVLKRGLWFDLNWRYAPYEKKLKQLQRLLKS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccttaactcccatcaaagatttaattggacaacagcgagactatttggcgacc
ggaaattctaaaaaaattgagtttagaattaatcaacttaaaaagctaaaacaagccgtt
attgatcataagcaagctgttattgacgctttaaaagctgatctcaataaaccagaattt
gaagcctactttgaaattatcggcgttaatgaagagattgattatgcgataaaaaacctc
aaatcttgggttaaacccaaatcagtcaaaactcctttaactcaatttccggcttctgct
aaaatttatcctgaacctctaggagtggttttaattattggcccttggaattatcctttt
tctctaattctgactcctttagtaggggcgatcgctgccggtaattgtgctatacttaag
ccttctgaacttgctccccatacttctggggtggtagctcaattaatcaaaaataccttt
gatcccgcttatattaatgtagttgaaggaggaatagaaaccagtcaacaacttttaggg
gaaaaatttgaccatatcttttttacaggaggaacaaaagtcggaaaaattatcatggaa
gccgccgctaaacatctcactcctgttaccctagaattgggaggaaaaagcccctgtatt
gtagatagcaatatcaatttatcagaaaccgctaaacgaattacttggggaaaatttatt
aatagtggtcaaacttgtattgctccggattatttattagttcaaaaaagcattaaaaat
caattagttgaacatattaaacaacagattcaagaattttatggagatgatccccaaaaa
agtccagactatgcccggattattaatgagcgacaatttgaacgcttaaaaggattactc
gctgacggtaaaattattgtaggcggccaaactgaggcaacaactcgctatattgcgccg
acagtgatagaagtcgtttcccttgactcccccgtcatggaagaggaaatttttgggcct
attctgccgattatcgaatatgaacagataaacgaagcgatcgctatcattaatcgtcgc
tcaaaacccctagccctttatctattctccaatgataaaactaaacagcaacaagttcta
gaacaaacctcatccggaggagtttgtctcaatgatacggtgttgcaagtgggagtcatt
gatttaccttttgggggtgtaggagacagtgggataggcaattatcatgggttggccagt
tttaaaaccttctctcactacaaaagtgttttaaaacgagggttatggtttgatttgaat
tggcgttatgctccttatgaaaaaaaattaaagcagttacagcgactccttaaaagttga

DBGET integrated database retrieval system