KEGG   Gloeothece citriformis: PCC7424_0443
Entry
PCC7424_0443      CDS       T00808                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyc  Gloeothece citriformis
Pathway
cyc00010  Glycolysis / Gluconeogenesis
cyc00020  Citrate cycle (TCA cycle)
cyc00620  Pyruvate metabolism
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01120  Microbial metabolism in diverse environments
cyc01200  Carbon metabolism
Module
cyc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_0443
   00020 Citrate cycle (TCA cycle)
    PCC7424_0443
   00620 Pyruvate metabolism
    PCC7424_0443
Enzymes [BR:cyc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PCC7424_0443
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Aminotran_1_2 Rib_recp_KP_reg MadL TraO
Other DBs
NCBI-ProteinID: ACK68909
UniProt: B7KD89
LinkDB
Position
485417..486727
AA seq 436 aa
MIHDIFMPALSSTMTEGKIVSWVKSPGDKVVKGETVVVVESDKADMDVESFFDGYLAVII
VNAGEEAPVGAPIALVAETEAEIQQAQAQASSGQASAPAPQEAQPAPEPAMAAFASTPAS
SNAGSSAPSQTNGRLVASPRAKKLAKELGVDLKTIRGSGPHGRITGEDVEQAVGKAPQPA
AQPISAPVSAPTPQPTPQPAPVPAVAAPVSVAPGEVVPFNTLQKAVVQNMMASMQAPMFR
VGYTITTDALDDLYKKVKSKGVTMSALLAKAVALSLQKHPVVNASYTEKGIQYNSSINIA
VAVAMPDGGLITPVLRNADQTDLYSLSRQWKDLVDRARAKQLQPEEYSTGTFTISNLGMF
GVDRFDAILPVGQGSILAIGASRPQVVATPEGLLGVKRQMTVNITCDHRIIYGADAAGFL
QDLAKIIETDPQSLTL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgatccacgatatatttatgcccgctctcagttctactatgaccgaagggaaaatcgtc
tcttgggtaaaatctcccggagataaagtggtaaaaggagaaacagtggtcgtggtcgag
tcagacaaagccgacatggatgtagaatccttctttgatggttatttagccgttattatt
gttaatgccggagaagaagcccccgtcggcgctcccattgccctggtagccgaaaccgaa
gcagaaatacaacaagcccaagcccaagcctcctctggacaagccagtgccccggctcca
caagaagcacaacccgccccagaaccggcgatggctgcctttgcaagcactcccgcctct
agtaatgccgggtcttctgcacctagccaaaccaatggccgccttgtggcctctcccaga
gccaaaaaactcgccaaagaattaggagtcgacctcaaaaccatcagaggcagtggccct
catgggagaattacaggagaagatgtagaacaggccgtcgggaaagcgccccaacccgca
gcgcaacccatttccgcccccgtttctgccccaactcctcaacccacccctcaaccggct
cccgttcctgctgtagccgctcccgtgagtgttgcacctggggaagtcgtgccgtttaac
accctacagaaagcggtggtacagaacatgatggcgagtatgcaagctccgatgttccgg
gtcggatacaccatcaccaccgatgccttagatgacttgtataaaaaagtcaaaagtaaa
ggcgtgaccatgagtgctttattagctaaagcggtagccctcagcctacaaaagcatcct
gttgtcaacgcaagttatacagaaaaaggaatacaatacaactcctcgatcaatattgcg
gttgctgtcgccatgccggacggagggttaattaccccagtcttaagaaacgcagatcaa
accgatctttattctctctcccgtcagtggaaagatctagtcgatcgcgccagagccaaa
caattacaacccgaagaatatagcaccggaaccttcaccatttctaacttaggaatgttt
ggggtcgatcgctttgacgctattttacccgtaggacaagggtctatattagccattggt
gcatcccgtccccaagtcgttgctactccagaaggactattaggagtcaaacgtcagatg
acagttaacatcacctgcgatcatcgtattatttatggcgctgatgctgccggtttctta
caagacttagcaaaaatcattgaaaccgatcctcaatccttaaccttgtaa

DBGET integrated database retrieval system