KEGG   Cyanothece sp. PCC 7424: PCC7424_0443Help
Entry
PCC7424_0443      CDS       T00808                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00010  Glycolysis / Gluconeogenesis
cyc00020  Citrate cycle (TCA cycle)
cyc00620  Pyruvate metabolism
cyc01100  Metabolic pathways
cyc01110  Biosynthesis of secondary metabolites
cyc01120  Microbial metabolism in diverse environments
cyc01130  Biosynthesis of antibiotics
cyc01200  Carbon metabolism
Module
cyc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7424_0443
   00020 Citrate cycle (TCA cycle)
    PCC7424_0443
   00620 Pyruvate metabolism
    PCC7424_0443
Enzymes [BR:cyc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PCC7424_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL Aminotran_1_2 TraO
Motif
Other DBs
NCBI-ProteinID: ACK68909
UniProt: B7KD89
LinkDB All DBs
Position
485417..486727
Genome map
AA seq 436 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWVKSPGDKVVKGETVVVVESDKADMDVESFFDGYLAVII
VNAGEEAPVGAPIALVAETEAEIQQAQAQASSGQASAPAPQEAQPAPEPAMAAFASTPAS
SNAGSSAPSQTNGRLVASPRAKKLAKELGVDLKTIRGSGPHGRITGEDVEQAVGKAPQPA
AQPISAPVSAPTPQPTPQPAPVPAVAAPVSVAPGEVVPFNTLQKAVVQNMMASMQAPMFR
VGYTITTDALDDLYKKVKSKGVTMSALLAKAVALSLQKHPVVNASYTEKGIQYNSSINIA
VAVAMPDGGLITPVLRNADQTDLYSLSRQWKDLVDRARAKQLQPEEYSTGTFTISNLGMF
GVDRFDAILPVGQGSILAIGASRPQVVATPEGLLGVKRQMTVNITCDHRIIYGADAAGFL
QDLAKIIETDPQSLTL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgatatatttatgcccgctctcagttctactatgaccgaagggaaaatcgtc
tcttgggtaaaatctcccggagataaagtggtaaaaggagaaacagtggtcgtggtcgag
tcagacaaagccgacatggatgtagaatccttctttgatggttatttagccgttattatt
gttaatgccggagaagaagcccccgtcggcgctcccattgccctggtagccgaaaccgaa
gcagaaatacaacaagcccaagcccaagcctcctctggacaagccagtgccccggctcca
caagaagcacaacccgccccagaaccggcgatggctgcctttgcaagcactcccgcctct
agtaatgccgggtcttctgcacctagccaaaccaatggccgccttgtggcctctcccaga
gccaaaaaactcgccaaagaattaggagtcgacctcaaaaccatcagaggcagtggccct
catgggagaattacaggagaagatgtagaacaggccgtcgggaaagcgccccaacccgca
gcgcaacccatttccgcccccgtttctgccccaactcctcaacccacccctcaaccggct
cccgttcctgctgtagccgctcccgtgagtgttgcacctggggaagtcgtgccgtttaac
accctacagaaagcggtggtacagaacatgatggcgagtatgcaagctccgatgttccgg
gtcggatacaccatcaccaccgatgccttagatgacttgtataaaaaagtcaaaagtaaa
ggcgtgaccatgagtgctttattagctaaagcggtagccctcagcctacaaaagcatcct
gttgtcaacgcaagttatacagaaaaaggaatacaatacaactcctcgatcaatattgcg
gttgctgtcgccatgccggacggagggttaattaccccagtcttaagaaacgcagatcaa
accgatctttattctctctcccgtcagtggaaagatctagtcgatcgcgccagagccaaa
caattacaacccgaagaatatagcaccggaaccttcaccatttctaacttaggaatgttt
ggggtcgatcgctttgacgctattttacccgtaggacaagggtctatattagccattggt
gcatcccgtccccaagtcgttgctactccagaaggactattaggagtcaaacgtcagatg
acagttaacatcacctgcgatcatcgtattatttatggcgctgatgctgccggtttctta
caagacttagcaaaaatcattgaaaccgatcctcaatccttaaccttgtaa

DBGET integrated database retrieval system