KEGG   Cyanothece sp. PCC 7424: PCC7424_1367Help
Entry
PCC7424_1367      CDS       T00808                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00630  Glyoxylate and dicarboxylate metabolism
cyc00710  Carbon fixation in photosynthetic organisms
cyc01100  Metabolic pathways
cyc01120  Microbial metabolism in diverse environments
cyc01200  Carbon metabolism
Module
cyc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cyc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cyc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PCC7424_1367
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PCC7424_1367
Enzymes [BR:cyc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PCC7424_1367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACK69811
UniProt: B7K7P3
LinkDB All DBs
Position
complement(1503225..1504643)
Genome map
AA seq 472 aa AA seqDB search
MVQSKAKAGFQAGVKDYRLTYYTPDYTPKDTDLLACFRVTPQPGVPPEEAGAAVAAESST
GTWTTVWTDGLTDLDRYKGRCYDIEPVPNEDNQYFCFVAYPLDLFEEGSVTNILTSIVGN
VFGFKALRALRLEDIRFPVALLKTFQGPPHGITVERDKLNKYGRPLLGCTIKPKLGLSAK
NYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVQEAIEKSQAETNEIKGHYLNVT
AGTLEEMMKRAEFAKEIKTPIIMHDYLTGGFTANTTLARWCRDNGVLLHIHRAMHAVIDR
QKNHGIHFRVLAKCLRMSGGDHLHSGTVVGKLEGERGITMGFVDLMREDYVEEDRARGIF
FTQDWASMPGVMPVASGGIHVWHMPALVEIFGDDSCLQFGGGTLGHPWGNAPGATANRVA
LEACIQARNEGRSLAREGNEVIREAARWSPELAAACELWKEIKFEFEAMDTL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaatccaaagccaaagcagggtttcaggctggagttaaggactaccgcctaacc
tactacacccccgactatacccccaaagataccgaccttctcgcctgcttccgggtaaca
cctcagcctggtgttcctcctgaagaagcaggagcagcagtagcggctgaatcttctaca
ggaacttggacaaccgtttggacagacgggttaactgacttagatcgttataaaggtcgt
tgctatgacatcgaacccgtacccaacgaagataatcagtatttttgctttgttgcttat
cctttagatctatttgaagaaggatctgttaccaatattctcacctctattgtaggtaac
gttttcgggtttaaagctctacgggcactccgtttagaagatattcgcttccccgttgca
ctgctcaaaaccttccaagggcctcctcacgggatcaccgttgagcgcgataaattgaat
aagtatggtcgtcctctgttaggttgtaccattaaacccaaactcggtttatccgctaaa
aactacggtcgtgcggtttatgagtgtcttcgcggtggtttagacttcaccaaagacgac
gaaaatattaactctcagcctttcatgcgctggcgcgatcgtttcctcttcgttcaagaa
gcgatcgaaaaatctcaagctgaaaccaacgagatcaaagggcactacctcaacgtaact
gccggaactctcgaagaaatgatgaaacgggccgaattcgctaaagaaatcaaaaccccc
atcatcatgcacgactacctcaccggtgggtttaccgctaacaccaccttggcaagatgg
tgtcgtgacaatggagtattactccacatccacagagcgatgcacgcggttatcgaccgt
caaaagaatcacgggattcacttccgagtcttagctaagtgtttacggatgtctggtggg
gatcacctccactctggaacagttgtcggtaagctcgaaggtgaacgcggtattacgatg
ggatttgttgacctcatgcgtgaggactacgtagaagaagatcgcgcacgcggtattttc
ttcacccaagactgggcttctatgcctggtgtaatgcccgttgcttctggtggtatccac
gtatggcatatgcccgccttagttgaaatcttcggcgatgactcttgcttacagttcggt
ggtggaactctcggacacccctggggtaatgctcctggtgcaaccgctaaccgggtcgct
cttgaagcttgtatccaagctcgtaacgaaggtcgttccctcgctcgtgaaggtaacgaa
gttatccgggaagccgctcgttggagtcctgaattagccgcagcttgcgaactgtggaaa
gaaattaagttcgagtttgaggcaatggatacactgtaa

DBGET integrated database retrieval system