KEGG   Cyanothece sp. PCC 7424: PCC7424_2213Help
Entry
PCC7424_2213      CDS       T00808                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:cyc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PCC7424_2213
Enzymes [BR:cyc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     PCC7424_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACK70635
UniProt: B7KGG4
LinkDB All DBs
Position
2456944..2458443
Genome map
AA seq 499 aa AA seqDB search
MPPLTCLNYINGQWLPAKVRELSESRNPANWSEVVATFPLSTSADVNVAVEAAKNAYPSW
RLVPAPERAEYLQRVAQILSQRKEEIATLMTREMGKPIAEARGDVQEGIDCAFYYAGEGR
RLFGQTTPSELHNKFAMTMRMPIGVCALITPWNFPVAIPCWKSLPALVCGNTMILKPAKD
TPACATALIEVFHQAGFPPGVVNLVHGIGPEVGHDLLEHPEVDLVSFTGSSLVGAQVGEI
CGRTHKRVCLELGGKNAQIVMEDANLELALEGALWGAFGTTGQRCTATSRLILHRDIKAE
FTEKLLEKTAKLRLGSGLDPNTDIGPLISSTQREKVNKYMEIAQEEGAKILCGGNKPQDP
ALKQGFFFEPTILDGVTSQMRVAQEEIFGPVVCLMEVNSFSEAIALLNDTPYGLSSSIYT
QDINRAFQAMRDLEAGITYINGPTIGAEVHLPFGGVKQTGNGHREAGTSALDVFSEWKTV
YVDFSGRLQRAQIDNRNRS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgccccctttaacttgccttaattatatcaacggccaatggctaccggccaaagtcaga
gagctttctgaaagtcgcaacccggctaactggagtgaagtggttgctacttttccctta
tccacgagtgctgatgtcaatgtcgcagtagaagccgccaaaaacgcttatccgagttgg
cgtttagttcctgcaccggaaagagcagaatatcttcaacgagtcgctcaaattttatcc
caaagaaaagaagaaattgctaccctaatgactagggaaatgggaaaaccgatcgcagaa
gccagaggagatgtacaagaaggaatagactgcgccttttattatgcaggagaaggacgg
cgtttattcggacaaacgaccccatcagaactccataataagtttgcgatgaccatgcgg
atgcctataggggtgtgtgctttaattaccccttggaattttccggtggccattccctgc
tggaagtccttaccggctttagtttgtggcaataccatgatcctcaaaccggctaaagat
accccggcttgtgccactgccttaatagaagttttccatcaagccggctttcctccagga
gtggtaaatttagttcatggtatcgggcccgaagtcggtcatgatctcctagaacatcca
gaagtggatttagtttcctttaccggttcttccctcgtcggagcgcaagttggggaaatt
tgtggccgcacccataaacgggtttgtctggaattaggcggaaaaaacgctcaaattgtc
atggaagatgctaatttagaactggcattagaaggcgcattatggggagcgtttggcaca
accggacaacgatgtaccgccaccagtcgtttaattttgcatcgggatattaaagcagaa
tttacggaaaagttactcgaaaaaacggcaaaacttcgtctaggttctggacttgatccc
aatacggatatcgggccgttaattagttctactcaacgggaaaaggtcaacaaatatatg
gagattgcccaagaagaaggggctaaaatattatgtggagggaataaaccccaggatccg
gccttaaaacaagggtttttctttgaaccgaccattttagatggagttacctctcaaatg
cgggtcgcacaagaagagatttttggccctgttgtgtgtttaatggaagtcaattctttt
tctgaagcgatcgccctgctcaatgatacaccctatgggttatcgtcttcgatttatacc
caagatatcaaccgagcttttcaggccatgcgagacttagaagccggtattacttatatt
aatggccccaccataggagcagaagtacatcttccttttggtggggtaaaacaaacgggt
aatggacaccgagaagccggaaccagtgccttagatgtgtttagtgaatggaaaacagtc
tatgttgatttttccggacggttacaacgagcgcaaattgataaccgaaatcgaagttaa

DBGET integrated database retrieval system