KEGG   Cyanothece sp. PCC 7424: PCC7424_3928Help
Entry
PCC7424_3928      CDS       T00808                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00500  Starch and sucrose metabolism
cyc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCC7424_3928
Enzymes [BR:cyc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PCC7424_3928
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PCC7424_3928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ACK72304
UniProt: B7KKH1
LinkDB All DBs
Position
4363227..4364861
Genome map
AA seq 544 aa AA seqDB search
MIMQNIWHKNAIIYSLDVETFMDSNGDGVGDFQGLIERLDYLSGLGINCLWLLPFYPSPN
RDNGYDVMDYYNVDPRLGTLGDFVEFMDRAREQGIHVLIDLVVNHTSIEHPWFQAARTDK
NSKYRHYYVWSENPPQDDVEEIVFPHAEDSIWEYDQQAEAYYLHHFYKEQPDLNIANSEV
REEIRKIINFWLQLGVSGFRVDAVPYLIKEIGVQAERHELESFLSEMREFLSLRRADAVL
LAEANVSPDLTCVYFGQGDRMNMLFNFYLNQQMFLALARQEANPIIDALKSLPKIPKQAQ
WLNFVRHHDELNLNQLENTQREEIFQVFAPEEAMQIYKGRGIRRRLPPMFGGDRRRIELT
YSLLFSLPGIPLLRYGDEIGMGDDLSLSDRDSVRTPMQWSSGQNGGFSTSDPEKLTQPMI
SQGEYSYKSVNVAASQRDPNSLLNWMDRLIRIRKQCSELGWGNWQILDTGEPCVFAHSCE
WNNKTVIAVHNLADKSCSIALKLDGSYYLDDLFGDHQYEVPGESHTISLEAYGYRWFRLN
PIKP
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgattatgcaaaatatttggcacaaaaatgcgattatttattccttagatgttgaaaca
tttatggattctaatggagatggcgtaggagatttccaaggattaattgagcgtttagat
tatttatctggattgggaattaattgtttatggcttctccccttttatccttctccaaat
cgagataatggctatgatgtaatggattattacaatgttgatccgcgtttgggaactttg
ggagattttgttgaatttatggatcgcgccagagaacaagggattcatgttttaatagat
ttagttgtcaatcacacttctattgagcatccctggtttcaagccgcacgaaccgataaa
aactctaaatatcgtcattactatgtgtggtcagaaaatcctcctcaagatgatgtagaa
gaaattgtttttccccatgcagaagatagtatttgggagtacgatcaacaggcagaagct
tattatttacaccatttctataaagaacagccagatttaaatattgctaattctgaagtt
cgggaagaaattcgcaaaattatcaatttttggctgcaattaggggtatcaggttttcga
gttgatgctgttccctatttaattaaagaaattggggttcaagctgaacgtcatgaactc
gaaagtttcttgagcgaaatgcgagaatttctctctttgcgtcgtgccgatgcagtgtta
ttagcagaagctaatgtatcgccggatttgacttgcgtttatttcggacaaggcgatcgc
atgaatatgctttttaatttttacttaaatcaacagatgttcctggcacttgctcgacaa
gaagccaatccgattatagatgccctcaaaagtttaccaaaaattccgaaacaagctcaa
tggcttaattttgtccgtcatcatgacgaacttaatcttaatcaacttgaaaacacacaa
cgagaagaaatttttcaagtctttgctcctgaagaagcgatgcaaatttataaaggacga
ggcattaggcggcgcttacctcccatgttcggcggagatcgacgacgcatagaacttact
tacagtttgctattttccctacctggaattcctttactgcgttatggggatgaaatagga
atgggtgacgatctttctttatcagatagagacagtgttcggactcctatgcaatggtct
agcgggcaaaacggtgggttttcaacgtccgatcctgaaaaattgactcaaccaatgatt
tctcaaggagaatatagctataagtctgttaatgtggctgcaagtcagcgagatcctaac
tctttattaaattggatggatcgcctcattcgcattagaaaacaatgttctgagttggga
tggggtaattggcaaattttagacactggagaaccttgtgtttttgcccattcttgtgag
tggaataataaaactgtgattgcggttcacaatttagcggataaatcttgttcgatcgct
ctgaagttagatggttcttattatttagatgacttatttggggatcatcaatatgaagta
ccaggagaatcccacactatttctttagaagcttatggatatcgctggtttcgtctgaat
cccataaaaccatga

DBGET integrated database retrieval system