KEGG   Cyanothece sp. PCC 7424: PCC7424_4049Help
Entry
PCC7424_4049      CDS       T00808                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cyc  Cyanothece sp. PCC 7424
Pathway
cyc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cyc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PCC7424_4049
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyc02000]
    PCC7424_4049
Enzymes [BR:cyc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PCC7424_4049
Transporters [BR:cyc02000]
 Other Transporters
  Pores ion channels [TC:1]
   PCC7424_4049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_C_5 GST_C_2 GST_N GST_C GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ACK72423
UniProt: B7KL51
LinkDB All DBs
Position
4487272..4488468
Genome map
AA seq 398 aa AA seqDB search
MTSPLSWTQLEALTHFQTEPINGSTNAQATLRLFNHDESEVRVTLYRDNHAWCPYCQKVW
LWLEEKQIPYRIKKVTMFCYGQKESWYKRIVPSGMLPALELDGQILTESDDILIALEKVF
GPLNQSMMAKEVIPLRQLERLLFRAWCSWLCYPTRSSKQEQQNRQQFIKVVEMVEDALSR
TDGPYFLDPFGTVDVIFTPYVERMNASLYYYKGYSLREENPHLAKWFEAMESRPTYRGTQ
SDFHTHAHDLPPQMGGCYENGEPQMLINKARVDNGPWFGLPDVTYPEPETSRAEALQRVL
KHRNNIIKVNPMDDVLFDQALRCALTYMITEQVCTPPPNSDIGLRYLRDRINVPRDMSIY
AAKRLREALETTAALVGDRQGTPIPLNHRRDQDPVNFR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccccctaagttggacacaattagaagcgctgacccattttcaaacagagccg
attaacggttcgaccaacgcgcaagccacattacgcctttttaatcatgacgaatctgag
gttcgtgtgaccctatatcgggataaccatgcttggtgtccctattgccaaaaagtttgg
ctgtggttggaagaaaaacaaatcccttaccgcatcaaaaaagtaaccatgttctgttac
ggacaaaaagaaagttggtataagcgcattgtgccatcgggaatgttacccgcactggag
ttagacggacaaattctcaccgaaagtgatgacattttaatcgccttagaaaaagttttt
gggcctttaaatcaaagtatgatggcaaaagaggtcatccctttacgacaattagaacga
cttctatttcgagcgtggtgtagttggctttgttatccgactcgttcctctaaacaagaa
caacaaaaccgccaacaattcatcaaagtcgtagaaatggtagaagatgccttaagtcgc
accgatggcccctactttttagacccatttggaacggtggatgtaatttttacgccttat
gtggaacggatgaatgctagtctttattactacaaaggctactctctacgagaagaaaac
cctcatttagccaaatggtttgaggcgatggaaagtcgtcccacttatcgaggcactcaa
agcgattttcatacccatgctcatgatttaccgcctcaaatgggaggttgctatgaaaac
ggagagcctcaaatgctgattaataaagcgcgggtagataatggcccttggtttggactc
cccgatgtcacttaccctgaacccgaaacctctcgcgctgaagcacttcaacgggtactc
aaacatcgtaacaatatcattaaggtcaatccaatggatgatgttttgtttgatcaagct
ctccgttgtgctttgacttatatgatcacagagcaagtgtgtactcctccccccaactcg
gacattggcttaagatatttacgcgatcgaattaatgtacccagagatatgtcgatttac
gctgctaaacgcttgcgagaagcactggaaacaacggcggctttagtcggggatagacag
gggactccaattcctttaaatcatcggcgcgatcaagatccggttaattttaggtaa

DBGET integrated database retrieval system