KEGG   Cyanothece sp. PCC 7424: PCC7424_4198Help
Entry
PCC7424_4198      CDS       T00808                                 

Definition
(GenBank) glycosyl transferase group 1
Organism
cyc  Cyanothece sp. PCC 7424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: ACK72568
UniProt: B7KLJ6
LinkDB All DBs
Position
4651099..4652316
Genome map
AA seq 405 aa AA seqDB search
MKILLINDYGTATGGAELQMLSLRQNLIDRGHEVRLFSSKHTPVVNSPLLSDYECFGTDK
RLQVLSQTVNPSAYFRLRHALADFQPDVVHIRMFLWQLSPLILPLLKNIPCLYQTATYIP
ICPSGTKLLPNGLPCSEQQGLPCLRHGCVTPQTWAVLMLQRQLFEQWRSGLDLVVALSHA
MKEKIEAAGIKPVEVVYNGVPERPLRPPLPNLPLVAFAGRLVPEKGVSDLIKAFAQAKAF
VPDAQLTIAGQGVEQNNLQALAEKLGIAQSINWLGHISRDELEKRFDAAWVQVVPSLWDE
PFGNVTTEAMMRGTAVIANAVGAQPEIVQDGETGYIVPPQDIEALKDALVRLLMSRDLAE
KMGQAGRDRAMAHFSENRRTENFLNLYQRIQGLYNYPSKETLSLI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcttttaatcaacgattatgggacggctacaggaggcgcagaattacaaatg
ttatccctgcgccaaaatttaatcgatcggggtcatgaggttcgtttgttctctagtaaa
catacgccagtggtcaacagccccttattatctgactatgagtgttttgggacagataaa
cggctacaagttctctctcaaaccgtcaacccttcggcctatttccggctacgtcacgct
ttagcggattttcagccggatgtcgtgcatattcggatgtttttgtggcaactttccccg
ttaatattacccctgctcaaaaatatcccctgtctctatcaaactgcaacctatatcccc
atttgtccatcggggacaaaattattacccaacgggcttccctgttcggaacaacaagga
ctcccctgtttacgtcacggctgtgtcaccccccaaacctgggcagttttaatgctgcaa
agacaactgtttgagcaatggcgttccgggttagatctggtggttgctctgagccatgcc
atgaaagaaaaaatagaagctgcaggaattaagccggttgaagtggtttacaatggagtc
ccagaaagacccttacgtcctcctctgcctaatcttcctctggtggcttttgccgggcgt
ttagtcccagaaaagggagtcagcgacttaattaaagcctttgctcaggctaaagccttc
gttcctgatgcccaattaacgatcgccggtcaaggggttgagcaaaataatttacaagct
ctcgcagaaaaactgggaattgcccagagtataaattggttgggtcatatttcccgcgac
gaattagaaaaacggtttgatgcagcttgggtgcaggttgttccgtctttgtgggatgag
ccgtttgggaatgtgaccacagaagcgatgatgcgaggaacggcagttattgccaatgca
gtgggggcacagccggaaattgttcaggatggagaaacgggttatattgtcccaccccaa
gatatagaggcgcttaaggatgcactggtacgtcttttaatgagccgggacttggcggaa
aaaatggggcaagccggacgagatagggcgatggctcattttagcgaaaatcgccgtaca
gagaactttttaaacctgtatcagcgaattcaaggactatataactatccttcaaaagag
accttaagcctaatttaa

DBGET integrated database retrieval system