KEGG   Gloeothece citriformis: PCC7424_4425Help
Entry
PCC7424_4425      CDS       T00808                                 

Definition
(GenBank) glycosyl transferase family 2
  KO
K19003  1,2-diacylglycerol 3-beta-glucosyltransferase [EC:2.4.1.336]
Organism
cyc  Gloeothece citriformis
Pathway
cyc00561  Glycerolipid metabolism
cyc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PCC7424_4425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cyc01003]
    PCC7424_4425
Enzymes [BR:cyc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.336  monoglucosyldiacylglycerol synthase
     PCC7424_4425
Glycosyltransferases [BR:cyc01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   PCC7424_4425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Glyco_tranf_2_4 Chitin_synth_2
Motif
Other DBs
NCBI-ProteinID: ACK72789
UniProt: B7K920
LinkDB All DBs
Position
4901720..4903150
Genome map
AA seq 476 aa AA seqDB search
MPQNYWTDNDPDQDFDPISSLLSEWTDPEDEEEEFRSDFFQGLSGRRRKAALMLMMIWGV
TIGLHLVTWGTWVVMAITGMIVIHALRLITATPEPTPEPLSDEALKDAPFISLLVAAKNE
EAVISNLVNLLCNLNYPTNKYEVWIIDDYSTDKTPQILDNLAKQYSQLNVVHRPANAGGG
KSGALNEVLPLTQGEIIGVFDADARISPDLLRSVVPLFENPEMGAVQVRKAIANASENFW
TKGQMAEMALDSYFQQKRIAIGGIGELRGNGQFVRRTALERCGKWNEQTITDDLDLTIRL
HLDNWKIGFLVDPDVEEEGVTNAIALWHQRNRWAEGGYQRYLDYWRLILSPRMGLKKKVD
MITFIMIQYLLPSAAIPDFVMMLTRDRLPIFSPASSIVISLSCWGMYSGLKRIRKGEALS
FTDLLAVGWQTLRGTLYMMHWFIIIPSVTARMSIRPKRLKWVKTVHQGTGEESFEF
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaaactattggactgataacgatcccgatcaagatttcgaccctattagctct
ttactgtcggaatggacagatcccgaagacgaagaagaagaatttagaagtgactttttc
caaggattatcaggacgtaggcgcaaagcggccttaatgttaatgatgatttggggagta
accatcggactccatttagtcacttggggaacttgggttgtgatggcaattacggggatg
attgtgattcatgccctgcgtctaattacggctacccctgaaccgacaccagaaccttta
tcagatgaagcgcttaaagatgccccttttatctctttattagtagccgctaaaaatgaa
gaagcggtcattagtaatttagtcaatttattatgtaatctgaattatccaaccaataaa
tatgaagtctggattattgatgactacagcaccgataaaaccccacaaattttagacaat
ttagctaaacaatactctcaattaaatgtggttcatcgtccagctaatgcaggaggtggg
aagtcaggagcgcttaatgaagtcttgcctctgactcaaggcgaaattatcggggttttt
gatgcagatgcccggatttctccagatttactccggtctgttgttcctttatttgaaaac
ccagaaatgggagcagtacaagttcgtaaagcgatcgctaatgcctctgaaaacttttgg
actaagggacaaatggcagaaatggccttagatagttatttccaacaaaaacgcatcgct
atcggtggaatcggagaattgagaggcaatggtcaatttgtccgacgaactgctttagaa
agatgtggtaaatggaatgagcaaaccattaccgatgacctggatttaaccatccgctta
cacttagataattggaaaattggctttttagtcgatcccgatgtagaagaagaaggggtc
acgaatgcgatcgctttgtggcatcaacgcaaccgatgggcagagggaggttatcaacgt
tatctcgactattggcgcttaattttgagtcctcgcatgggattgaagaaaaaagtcgat
atgatcacttttattatgattcagtatcttcttccttcagcagctatccccgattttgtg
atgatgctcacccgcgatcgcttgccgatatttagccctgcatcaagtattgtgatttca
ctgtcttgttgggggatgtatagcggattaaaacgcatccgtaaaggggaagctttaagt
tttacggatttattagccgttggatggcaaactttgagagggacgttgtatatgatgcac
tggtttattattattcccagtgtgacagcccggatgtctattcgtcctaagcggttaaaa
tgggtgaaaaccgttcatcaaggcacgggagaagaaagttttgagttttaa

DBGET integrated database retrieval system