KEGG   Cyanothece sp. PCC 7424: PCC7424_4520Help
Entry
PCC7424_4520      CDS       T00808                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cyc  Cyanothece sp. PCC 7424
Brite
Enzymes [BR:cyc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PCC7424_4520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACK72883
UniProt: B7KAA9
LinkDB All DBs
Position
complement(4998741..4999340)
Genome map
AA seq 199 aa AA seqDB search
MAYKLPDLPYDYTALEPHISKSTLEFHHDKHHAAYVNNFNKAVEGTELDSMSIEDVIKKI
AGDSSKTGLFNNAAQAWNHTFYWNCMKPNGGGTPSGALADKINADFGSFDKFVEEFKNAG
GTQFGSGWAWLVLDNGTLKVTKTPNADNPLTSGQVPLLTMDVWEHAYYLDYQNSRPGYME
KFINNLINWDFVAENFSKA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcttataaattacctgatttaccctatgattacacggctctagagcctcatatttct
aaatcaacccttgagtttcaccacgacaagcaccatgcggcttatgtcaataactttaat
aaagctgtcgaagggactgagttagattctatgtccattgaagacgtaatcaaaaagata
gctggtgattcttccaagactggtcttttcaataatgcagcccaagcctggaatcatact
ttttattggaattgtatgaaacccaatggaggtggaactcctagcggtgctttagctgat
aaaattaacgctgattttggtagcttcgacaagtttgttgaagaattcaaaaatgccggt
ggcactcaatttggcagtggttgggcttggttagttcttgacaatggaactttaaaagta
accaaaactcccaacgctgataaccctttaacctctggacaagttcctttactgacaatg
gatgtttgggaacacgcttattatttagattatcaaaatagccgtcctggctatatggaa
aaattcatcaataatctcattaactgggattttgtggctgaaaatttttctaaagcataa

DBGET integrated database retrieval system