KEGG   Gloeothece citriformis: PCC7424_4520
Entry
PCC7424_4520      CDS       T00808                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cyc  Gloeothece citriformis
Brite
Enzymes [BR:cyc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PCC7424_4520
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: ACK72883
UniProt: B7KAA9
LinkDB
Position
complement(4998741..4999340)
AA seq 199 aa
MAYKLPDLPYDYTALEPHISKSTLEFHHDKHHAAYVNNFNKAVEGTELDSMSIEDVIKKI
AGDSSKTGLFNNAAQAWNHTFYWNCMKPNGGGTPSGALADKINADFGSFDKFVEEFKNAG
GTQFGSGWAWLVLDNGTLKVTKTPNADNPLTSGQVPLLTMDVWEHAYYLDYQNSRPGYME
KFINNLINWDFVAENFSKA
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcttataaattacctgatttaccctatgattacacggctctagagcctcatatttct
aaatcaacccttgagtttcaccacgacaagcaccatgcggcttatgtcaataactttaat
aaagctgtcgaagggactgagttagattctatgtccattgaagacgtaatcaaaaagata
gctggtgattcttccaagactggtcttttcaataatgcagcccaagcctggaatcatact
ttttattggaattgtatgaaacccaatggaggtggaactcctagcggtgctttagctgat
aaaattaacgctgattttggtagcttcgacaagtttgttgaagaattcaaaaatgccggt
ggcactcaatttggcagtggttgggcttggttagttcttgacaatggaactttaaaagta
accaaaactcccaacgctgataaccctttaacctctggacaagttcctttactgacaatg
gatgtttgggaacacgcttattatttagattatcaaaatagccgtcctggctatatggaa
aaattcatcaataatctcattaactgggattttgtggctgaaaatttttctaaagcataa

DBGET integrated database retrieval system