KEGG   Cyanothece sp. PCC 8802: Cyan8802_0334Help
Entry
Cyan8802_0334     CDS       T00968                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00010  Glycolysis / Gluconeogenesis
cyh00053  Ascorbate and aldarate metabolism
cyh00071  Fatty acid degradation
cyh00280  Valine, leucine and isoleucine degradation
cyh00310  Lysine degradation
cyh00330  Arginine and proline metabolism
cyh00340  Histidine metabolism
cyh00380  Tryptophan metabolism
cyh00410  beta-Alanine metabolism
cyh00561  Glycerolipid metabolism
cyh00620  Pyruvate metabolism
cyh00625  Chloroalkane and chloroalkene degradation
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01130  Biosynthesis of antibiotics
Module
cyh_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_0334
   00053 Ascorbate and aldarate metabolism
    Cyan8802_0334
   00620 Pyruvate metabolism
    Cyan8802_0334
  Lipid metabolism
   00071 Fatty acid degradation
    Cyan8802_0334
   00561 Glycerolipid metabolism
    Cyan8802_0334
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cyan8802_0334
   00310 Lysine degradation
    Cyan8802_0334
   00330 Arginine and proline metabolism
    Cyan8802_0334
   00340 Histidine metabolism
    Cyan8802_0334
   00380 Tryptophan metabolism
    Cyan8802_0334
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cyan8802_0334
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cyan8802_0334
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cyan8802_0334
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Cyan8802_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ACU99294
LinkDB All DBs
Position
323905..325302
Genome map
AA seq 465 aa AA seqDB search
MTTQIITSSVEDLIKQQRTFFATGQTKSVNFRLSQLKRLKQAIVNYKEPIINAVKIDLGR
PTYEACFELGTLREINFFLKRLKSWIKPQRVVPSLDQFPASAWVQSEPLGVVLIIGPWNY
PFQLMISPLVGAIAAGNCAILKPSEQASETSQVVAKLIQSTFDPNYIAVVEGDATVSQQL
LQQKFDHIFFTGGTTGGRIVMEAAAQYLTPVTLELGGKSPCIVDNEVNLDYAAKRIAWGK
FINAGQTCVAPDYVLVDYRIKQTLIEKLKQAIRSFYGDNPANSPDYGRIINERHFSRLRT
LLRCGQTIIGGQVDPKTRYIAPTILDGVSWDDPIMEEEIFGPILPILEYHNLEEAIAWIN
QRPKPLALYFFSRNQQKQRKILQSTSSGGVGLNDTVMQFTVWGLPFGGVGESGIGSYHGK
SSFDTFSHYKSVFNQSFWFDVPWRYAPYTQIKLNLIKRIVTGCRS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcagataataaccagttcagttgaagatttaattaaacaacaacggacattt
tttgcaacaggacagaccaaatcagtcaattttcggctaagtcaactcaaacgcttaaaa
caagcaattgttaattacaaggaacctattatcaacgcggttaaaattgatttaggtaga
ccaacctatgaagcttgttttgaactgggaaccttaagagagattaatttttttctaaaa
cggctgaaatcgtggataaaaccccaacgggtagttcctagtcttgatcaatttcctgcg
tcagcttgggtacaatcagaacccctaggagtcgtcttaattatcggcccttggaactat
ccctttcaactgatgatctctcccttagtaggggcgatcgcagccggaaattgtgctatc
cttaaaccgtcagaacaggcctctgagacttcccaagtggtggctaagttaattcaatca
acctttgaccctaattatattgcggtagtcgaaggcgatgcaacggtcagtcagcaattg
ctacagcaaaagtttgaccatatcttctttacgggggggactactgggggacgcatcgtc
atggaagcagccgctcaatatttaacccctgttaccttagaattaggggggaaaagtccc
tgtattgtcgataacgaagttaaccttgattatgctgctaaacgcattgcctggggcaaa
tttatcaatgccggtcaaacctgtgtcgcgcccgattatgtattagtagattatcgcatt
aaacagactcttatcgaaaaactaaaacaggcaatacgcagtttttatggggataatcca
gcgaatagcccggattatggcaggattattaatgaaaggcatttctcgcgtctcaggact
ttattaaggtgtggtcaaacaattatcgggggacaagttgacccgaaaacccgctatatt
gccccgactatcctagatggggtgagttgggatgaccccatcatggaagaggaaattttt
ggtccaattttgcctattttagaatatcacaatcttgaagaggcgatcgcttggattaat
caacgccctaaacccttagcattgtactttttttctcgaaatcagcaaaaacaacgcaaa
atcttgcagtcaacttcttcaggaggagtgggactcaatgatacggtcatgcagtttact
gtctggggtcttccctttgggggtgtgggggaaagtgggataggaagttatcacgggaaa
agcagttttgacactttttcccactataaaagcgtttttaatcaatctttctggttcgac
gtaccttggcgttatgccccctatactcagataaaactcaatttaattaagcgtattgtt
acgggttgtcgttcataa

DBGET integrated database retrieval system