KEGG   Rippkaea orientalis PCC 8802: Cyan8802_0404
Entry
Cyan8802_0404     CDS       T00968                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00020  Citrate cycle (TCA cycle)
cyh00190  Oxidative phosphorylation
cyh00650  Butanoate metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cyan8802_0404
   00650 Butanoate metabolism
    Cyan8802_0404
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Cyan8802_0404
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Cyan8802_0404
    1.3.5.4  fumarate reductase (quinol)
     Cyan8802_0404
SSDB
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_16 Fer4_7 Fer2 Fer4_18 Fer4_21 DUF2225 Fer4_15 Fer4_2
Other DBs
NCBI-ProteinID: ACU99363
LinkDB
Position
complement(396534..397523)
AA seq 329 aa
MQVLFKVLRQKSNHTPHFQSYTLEVESGNTILECLNRIKWEQDGTLAFRKNCRNTICGSC
SMRINGRSALACKENVGSELQQFSHTQSGELPEITIAPLGNLPVVKDLVVDMSKFWQKLE
AVEPYVSTQARDIPEREFLQTPEERSRLDQTGNCIMCGACYSECNAVMVNDSFVGPHALA
KAQRMVVDSRDTELEARLELYNQDTQGVWGCTRCYFCNAVCPMEVAPMDQIGRIKQEILD
RKDAQASRAIRHRKVLVELVKQGGWIDERKFGLLVVGNYWRDLLGLLSLVPLGLTMFSRG
KFPVSFESSEGTEEVRSLIESVKAVKSNQ
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcaggttctgtttaaagttcttcgacaaaaatctaatcatacaccccatttccagagc
tacaccctagaagttgagtcaggaaatactattctagaatgtctcaatcgaattaaatgg
gaacaagatgggactttagcctttcgcaaaaactgccgaaatactatctgtggcagttgt
agtatgagaattaatggtcgttctgccctagcgtgtaaggaaaatgtgggcagtgaactc
caacaatttagccacactcaaagcggagaactgccggaaattaccattgcacctttgggt
aatttgcctgtagttaaggatttagtggtggatatgtcgaaattctggcaaaaattagaa
gccgtagaaccctacgtcagtacccaagcaagagatatcccagaacgggaatttctgcaa
accccagaagagcgatcgcgtctcgatcaaaccggaaattgtattatgtgcggagcctgt
tattctgaatgtaatgcggtgatggtcaatgattctttcgtcggaccccacgctttagcc
aaagcacaacgcatggtggttgattcgcgcgatacagaactcgaagcccgtttagaactg
tataatcaagacacccaaggggtttggggctgcacccggtgttatttctgcaatgcggtt
tgtcccatggaagttgccccaatggatcaaattggacgcattaaacaagaaattttagac
cgcaaagatgcccaagccagtcgtgccattcgtcaccgtaaagtcttggtagaattggtc
aaacaagggggatggatagatgaacgcaagtttggtctattagtagtgggcaattattgg
cgagatttactaggattactcagtttagttcctttaggcttaacaatgttctctcgtggt
aagtttcctgtatcctttgaatcctcagaaggaactgaagaagtgcgatcgctcatcgaa
tctgtcaaagcagtaaaaagtaatcagtaa

KEGG   Rippkaea orientalis PCC 8802: Cyan8802_1882
Entry
Cyan8802_1882     CDS       T00968                                 

Definition
(GenBank) succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00020  Citrate cycle (TCA cycle)
cyh00190  Oxidative phosphorylation
cyh00650  Butanoate metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cyan8802_1882
   00650 Butanoate metabolism
    Cyan8802_1882
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Cyan8802_1882
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Cyan8802_1882
    1.3.5.4  fumarate reductase (quinol)
     Cyan8802_1882
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO GIDA Pyr_redox_2 HI0933_like Lycopene_cycl Pyr_redox FAD_oxidored Thi4
Other DBs
NCBI-ProteinID: ACV00779
LinkDB
Position
1916089..1917816
AA seq 575 aa
MLQHDVIIIGGGLAGCRAALEIKRLTPTVDVAVVAKTHPIRSHSVAAQGGIAASLKNVDP
NDSWEAHAFDTVKGSDYLADQDAVALLTQEAPNEIIDLEHLGVLFSRLDDGRIAQRAFGG
HTHNRTCYAADKTGHAILHELVNNLRRNGVTIYDEWYVMQLILEDGDAKGIVMYHIADGY
LEIVQTKVVMFATGGYGRVFNTTSNDYASTGDGLAMSAIAGIPLEDMEFVQFHPTGLYPV
GVLISEAVRGEGAYLINSQGRRFMEDYAPSRMELAPRDITSRAITREIRAGRGVYPDGRP
GGPCVYLDLRHMGKDMILSRVPFCWEEANRLVGVDAIYEPMPVRPTAHYCMGGIPVNTEG
RVRLSGTQLAEGFFAAGECACVSVHGANRLGSNSLLECVVYGRITGRNIAEYVQGRKFSD
FDVQGYLNAAKSRIETLLSKKGTVRIGALRQEFQDCMSDHCGVFRTQEGMQEGLNKIEAF
KQQYEEVYLDDQDTCWNTELIEAMELQSIMAVGEIILTSALNRRESRGAHSREDYTQRDD
PNFLKHTLAYYSPAGIDVQYMPVVINMFEPKERKY
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgttacaacacgatgtcattattattggtggtgggttagctggatgtcgcgccgcctta
gaaattaaacgcctcacccctaccgtggatgtagccgttgtcgccaaaacccaccccatc
cgttcccattccgtcgccgcccaaggagggatcgcagcgagtttaaaaaacgttgatcct
aatgatagttgggaagcccacgcttttgataccgtcaagggttcagactacctagccgac
caagatgccgtcgccttgttaactcaagaagcccccaatgagatcattgatttagagcat
ttaggggtgttattttcgcgtttagacgatggtagaatcgctcaaagagcctttggtggt
catacccacaaccgtacctgctacgccgccgataaaaccggccacgccattctccacgaa
ttagtcaacaacctacgacggaacggcgtgactatctacgacgaatggtacgtcatgcaa
ctgatcctcgaagacggggacgcaaaaggcatcgtcatgtaccatattgccgatggttat
ttggaaattgtccaaaccaaagtcgttatgttcgccacaggaggctatgggcgggttttc
aacactacgtctaatgattatgcctctacgggggacggcttagccatgtctgcgatcgcg
ggtattcccttggaagatatggaatttgtgcagtttcatcccactggattataccctgtt
ggggtcttaatttctgaagccgtacggggagaaggagcctatctcattaatagccaagga
cggcggtttatggaagattacgccccctcacgcatggaattagccccccgtgatattact
tcccgcgctattacccgcgaaattcgtgccggacggggagtatatcccgatggtcgtcca
gggggtccctgtgtctatctcgacttgcgtcacatgggtaaagacatgatcctcagtcgc
gttcccttctgttgggaggaagctaaccgactggtgggagtggatgctatttatgaaccg
atgcctgtgcgtcctactgcccattattgcatgggagggattcctgttaatactgaagga
cgggttcgcttgagtggaacgcagttggcagaggggttctttgcggccggggaatgtgcc
tgtgtgtcggttcatggggctaaccgtttaggcagtaattctttgctggaatgtgtcgtt
tatgggcgaattacggggcgcaatatcgctgaatatgtccagggtcgaaagttttctgac
tttgatgttcagggctatttaaacgcggctaaaagtcgtattgaaacccttttgagtaaa
aaaggaacagttcgcatcggggcattacggcaggaatttcaagactgtatgagtgaccat
tgtggggtgtttcggactcaagagggaatgcaagaaggactcaacaaaattgaagctttt
aaacaacaatacgaggaggtttatttagacgatcaagatacttgttggaataccgaatta
attgaggcaatggaattacaaagtattatggcagtgggggaaattattctcacttctgct
ttaaaccgtcgagaaagtcgcggggctcattcgcgggaagattatacccaacgcgatgat
cccaactttcttaagcatacgttagcctattattcccccgcaggaattgatgttcaatat
atgcctgtggtgattaatatgtttgaaccgaaagaacgcaaatattaa

KEGG   Rippkaea orientalis PCC 8802: Cyan8802_3151
Entry
Cyan8802_3151     CDS       T00968                                 

Definition
(GenBank) CoB--CoM heterodisulfide reductase
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00020  Citrate cycle (TCA cycle)
cyh00190  Oxidative phosphorylation
cyh00650  Butanoate metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cyan8802_3151
   00650 Butanoate metabolism
    Cyan8802_3151
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Cyan8802_3151
SSDB
Motif
Pfam: CCG
Other DBs
NCBI-ProteinID: ACV01990
LinkDB
Position
complement(3219506..3220399)
AA seq 297 aa
MLKYAYYPGCVAQGACRELYLSTAALTNALGIELIELKKAACCGSGTYKEDSQLLEDTVN
ARNIALAESLNLPLLTHCSTCQGVIGHVDERLKEAKIKDPEYFEQVNGFLKKEHCSPYQG
TSEVKHLLWALVADYGLENLKEKVKKKLSGLNCAAFYGCYLLRSQDHLPYDNKFAPESLE
NVFRTVGANPIYYQGRTQCCGWPLASYATKESFKLAGSHVLEAMEAGADCLVTPCPLCHL
NLDSRQPEVAKVINHKLGLPVLHLPQLVSLALGISPDKLGLDRHVVSTKPVLEKLGF
NT seq 894 nt   +upstreamnt  +downstreamnt
atgctgaaatacgcttattatccaggttgtgttgcccaaggggcctgtcgtgaactttat
ctgtctactgctgccttaacgaatgctttaggaatagaattaattgaactgaaaaaagca
gcctgttgtggttcaggaacctacaaagaagattcccaactcttggaagataccgttaat
gcgcgtaatattgccctcgcagagtcccttaatcttccgctattgacccattgtagcacc
tgtcaaggcgttattggccatgtggatgaacgtctgaaagaggctaaaattaaagatcca
gagtattttgaacaggtcaatggattcttaaaaaaagagcattgttccccctatcaagga
accagtgaagttaaacatttattatgggcattagtcgcagattatggattagaaaacctt
aaagaaaaggtcaaaaagaagctaagcggattaaattgtgcggcattttatgggtgttat
ttgttgcgatcgcaggatcatctcccttatgataataaatttgccccagagtccttagaa
aatgtcttccgtaccgttggagctaatccaatttactatcaaggacggactcaatgttgt
ggttggccattagccagttatgccacaaaagagtcttttaaactagcaggaagtcatgtc
ttagaagcaatggaagcaggggcagattgtttagttactccttgtcctctatgtcacctc
aatttagattctcgacaaccagaagtcgctaaagtgattaaccataaattagggttgcct
gtgctacatttaccccaattagtatctctagcgttaggcattagtcccgataaattaggc
ttagatcgtcatgttgtttcaacaaaacctgtgttagaaaagttgggattttaa

DBGET integrated database retrieval system