KEGG   Rippkaea orientalis PCC 8802: Cyan8802_0539
Entry
Cyan8802_0539     CDS       T00968                                 

Definition
(GenBank) malate dehydrogenase, NAD-dependent
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00020  Citrate cycle (TCA cycle)
cyh00270  Cysteine and methionine metabolism
cyh00620  Pyruvate metabolism
cyh00630  Glyoxylate and dicarboxylate metabolism
cyh00680  Methane metabolism
cyh00710  Carbon fixation in photosynthetic organisms
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Module
cyh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cyan8802_0539
   00620 Pyruvate metabolism
    Cyan8802_0539
   00630 Glyoxylate and dicarboxylate metabolism
    Cyan8802_0539
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan8802_0539
   00680 Methane metabolism
    Cyan8802_0539
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cyan8802_0539
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Cyan8802_0539
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 UDPG_MGDP_dh_N F420_oxidored NAD_Gly3P_dh_N TrkA_N Shikimate_DH
Other DBs
NCBI-ProteinID: ACU99486
LinkDB
Position
537158..538120
AA seq 320 aa
MNDFLSCHSLRVSVIGAGNVGRTLTQRIAEKNLADVVLLDIIEGLPQGIALDLMAAQGIE
LHDSLVIGTNRYEDTANSDIVVITAGRPRTPGLSRDDLLAINAKIVVNSAKEAIKYSPNA
IFLVITNPLDVMTYLVWKATGLPPHQVMGMAGVLDSSRLQSFISLELGISSANITALVLG
GHGDLMLPLPRYCTVNGVPITELLDQATIDRLVERTRNGGAEIVKLLQTGGAYYAPASSA
CLMIEAILRDQSRLLPAAAYLSGEYGLNDIFIGVPCLLGCRGVKQILEVSLTEAEKMSLH
ISANSVRKNVELALESVGMK
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaacgattttctgtcctgccactctctccgtgtttctgttattggtgcagggaacgtc
ggaagaaccctcacacaacgtattgctgaaaaaaacctagcggatgtggtgcttctcgat
attattgaaggattaccccaaggtattgcccttgatttaatggccgctcagggtattgaa
ttgcacgatagtctagtgatcggaaccaatcgctacgaagatacggctaactccgatatc
gtggtgattacggccggtcgtcctcggactcctggcttgagtcgggatgatttgctggcc
attaatgcaaaaatcgtcgttaattcagcaaaagaagcgattaaatactcgcctaatgcc
atttttttggtcattacgaatcctttggatgttatgacctatttagtctggaaagcaacg
ggactacctccccatcaagtcatgggtatggcaggggttctcgactcctcacgcttacaa
agctttatttccttagaattgggtatttctagcgcgaatattaccgctttggtgttaggc
ggccatggggatttgatgttaccgttgccccgttattgtaccgttaatggggttcccatt
acggaactgttggatcaggcaaccattgatcggctggtggaacggacccgtaacggtggg
gcagaaattgttaagttattgcaaacaggaggagcttattatgctccagcttcttcagct
tgcttgatgatagaagcaattttacgagatcagtcacgactgcttccggcggctgcttat
ctatccggagaatatgggttaaacgatatttttattggtgtgccctgtttgttgggatgt
cgtggggtcaaacaaattttagaagtgagtttgacggaagctgaaaaaatgtctctgcat
atttccgctaattctgttcgcaagaatgttgaattagccttagaatctgttggcatgaag
tag

DBGET integrated database retrieval system