KEGG   Rippkaea orientalis PCC 8802: Cyan8802_0543
Entry
Cyan8802_0543     CDS       T00968                                 

Definition
(GenBank) ATP-grasp domain protein
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00020  Citrate cycle (TCA cycle)
cyh00640  Propanoate metabolism
cyh00660  C5-Branched dibasic acid metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cyan8802_0543
   00640 Propanoate metabolism
    Cyan8802_0543
   00660 C5-Branched dibasic acid metabolism
    Cyan8802_0543
Enzymes [BR:cyh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cyan8802_0543
SSDB
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 CPSase_L_D2
Other DBs
NCBI-ProteinID: ACU99490
LinkDB
Position
complement(542282..543538)
AA seq 418 aa
MDLLEYQAKELFHRVGIPILPSQPIANLSEIKRLQIPYPVVLKSQVRSGGRGKAGGIRFV
ENTIDAIAAAQAIFSLPILGEYPEVILAEARYNTQAEFFLCVLFDYQLQCPVLLGSSQGG
IEVENLLSHIEKVVLDGEFSPFYARRLAIKMGLEGKLIHAVSSIIEKMYQLFREKDLDWI
EINPLAVSPTGEVMALDGKIAVNDSALPRHQDLLDLLTSQQSKASSMTLTSGKAEPWPPI
LQHLRSTSSKGEVGIISNSWGLALTTWDLLVKQKGKPDCAFVMLEKKPEKSIIEQFSLAL
AQAMQLTHLQVILINILGSPETAEAIAQAIADYYEPYSKQKNEDRLPRPTGANTSERQGR
RQNQTRSLSVTEPLPLVVRLVGGDIDAIKQHLSGLTIHWQEDLETAITQTLLSTSAKQ
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggacttactcgaataccaagctaaagaacttttccatcgtgtaggcattcccattttg
ccttcccaacccatagccaatctcagcgagatcaaacgtctccagattccctatcccgtc
gtattaaaatctcaagtccgttcggggggacgtggcaaagctggaggaattcgctttgtc
gaaaataccatcgatgcgatcgcagcagcccaagccatttttagtctaccgattttagga
gaatatcccgaagtaatcctcgcagaagctcgctacaacacccaagcggaattttttctc
tgtgttctgtttgattatcaactgcaatgtcccgtattactcggttcatcccaaggggga
attgaagtcgaaaacctcttaagtcacatcgaaaaagtggtcttagatggtgaattttcg
cctttttatgcccgtcggttagccattaagatgggactcgaaggtaaactcatccacgca
gtgagttcgattattgaaaaaatgtaccagctttttcgggaaaaagacctagattggata
gaaattaatcccctggccgtcagtcccaccggagaagtcatggcactcgatggtaaaatt
gccgtcaacgatagtgcccttcctcgtcatcaggacctcctagatctgttaacctcccaa
cagtctaaggcctctagtatgaccttaacctcaggaaaagccgaaccgtggccgcctatc
ctacaacatctacgatcaacctccagcaaaggagaagtcggcattattagtaatagttgg
ggactcgctttaaccacctgggatctcttagtgaagcagaagggaaaacccgattgtgct
tttgttatgctcgaaaaaaagcccgaaaaatctatcatagaacaattttccctagcctta
gctcaggcgatgcaattaacgcatttacaggttatcctaatcaatattttaggcagtcct
gaaaccgccgaggccatagcccaagcgatcgcggactattatgaaccgtactccaagcaa
aaaaatgaagatcgcttaccccgacccacaggagccaatacttccgaacgtcaaggtcgt
cgccaaaatcaaacccgttctctatcagtgactgaaccgttacccttggtggtgcgtctt
gtgggaggggatattgacgcaattaaacaacatctttctggtttaacgattcattggcag
gaagacttagaaacagcgatcacccaaacactattatcaacaagtgcgaaacaataa

KEGG   Rippkaea orientalis PCC 8802: Cyan8802_1216
Entry
Cyan8802_1216     CDS       T00968                                 

Definition
(GenBank) CoA-binding domain protein
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00020  Citrate cycle (TCA cycle)
cyh00640  Propanoate metabolism
cyh00660  C5-Branched dibasic acid metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cyan8802_1216
   00640 Propanoate metabolism
    Cyan8802_1216
   00660 C5-Branched dibasic acid metabolism
    Cyan8802_1216
Enzymes [BR:cyh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cyan8802_1216
SSDB
Motif
Pfam: CoA_binding Succ_CoA_lig CoA_binding_2
Other DBs
NCBI-ProteinID: ACV00141
LinkDB
Position
1235911..1236807
AA seq 298 aa
MKWQADSKVLIQGISTPLGAHYGARMKAFGTNIVAGISLDGETPDIKDLPIFNLVEQAIA
QVGEIDISLIFTPPYSVLDAALEAMTAGIQQLIIISSEVPPLDMLTILRQAEATNTFILG
PGSQGLIVPNTIWLGICEPQFYTPGAVGIISRGDRLLDEVARELTLNKFGQSLAVSLGTN
WVIGSNFEQWLQVMEEDDATQVIVLLGQANSSAEVAAAEYIASAIEKPVIAYITGLYAPI
ERSFRDAKTIVTTQLVSSSPQISTDQNVLTALKKARVKLAQRPSEIPKLVKTHGKPNK
NT seq 897 nt   +upstreamnt  +downstreamnt
atgaaatggcaagctgacagtaaagttcttattcaaggaatcagcactcccttaggggct
cactatggagcaagaatgaaagccttcgggacaaacattgtggccgggattagtttagat
ggggaaacccctgacatcaaagatttacccatttttaacttagttgagcaagcgatcgct
caagtaggagaaattgacatcagcttaatttttacccctccctattccgtcttagatgcg
gccttagaagccatgacggccggtattcaacagttaatcattatttcatcagaagttccc
cccctggatatgctcaccattctgcgtcaagcagaagccaccaatacctttattttggga
ccagggagtcaagggttaattgtccctaatacaatctggttagggatctgtgagcctcaa
ttttatacccccggagcagtgggcattattagtcgaggcgatcgcctcttagatgaagtt
gctagagagttaaccctcaacaaatttggacaatctctagcggtgagtttagggactaat
tgggtgattggttctaattttgagcaatggctacaggtcatggaagaagatgacgcgacc
caggtgattgttcttctcggacaagccaacagtagtgctgaagtggcggcggccgaatat
attgcttcggccattgaaaaaccggtgattgcctatattactggactctatgcccccatc
gagcgcagttttcgagatgctaaaaccattgttaccacccaattagtttcttcaagtccc
cagatttctacagaccaaaacgtcctaacggctctcaaaaaagctagggtcaaactagct
cagcgtccgtcagaaattcctaaattagtgaaaacccatggcaaacctaataaatag

DBGET integrated database retrieval system