KEGG   Rippkaea orientalis PCC 8802: Cyan8802_1261
Entry
Cyan8802_1261     CDS       T00968                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00010  Glycolysis / Gluconeogenesis
cyh00020  Citrate cycle (TCA cycle)
cyh00620  Pyruvate metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Module
cyh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_1261
   00020 Citrate cycle (TCA cycle)
    Cyan8802_1261
   00620 Pyruvate metabolism
    Cyan8802_1261
Enzymes [BR:cyh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cyan8802_1261
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: ACV00184
LinkDB
Position
complement(1282328..1283608)
AA seq 426 aa
MIHDIFMPALSSTMTEGKIVSWVKSPGDKVAKGETVVVVESDKADMDVESFYEGYLATIL
VEAGQEAPVGTAIALIAETEAEITQAQQQQKPPSATAEPSRETTSPPVASPQPVPTVTAT
PTVTASNGNGRTVASPRAKKLAKELGVDLKTLRGSGPYGRIVAGDVERATSKVTTVTPTL
TPTPTVQPTPTPSTPPTPVPATPGETVPLTTLQKAVVQNMVATVQVPTYHVGYTITTDAL
DKLYKQLKSKGVTMTALLAKAVAMAVQKHPLVNASYTDQGIKYNGSINVALAVAMDDGGL
ITPVLQNADQVDIYSLSRTWKDLVDRARSKQLQPQEYNSGTITVSNLGMFGVDRFDAILP
PGQGAILAIGASRPQVVATPDGLIGVQRQMAVNITCDHRVIYGAHAAAFLQDLAKVIETD
VQSLTM
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgattcacgacatcttcatgcctgcactcagttctaccatgaccgaaggaaaaatcgtc
tcttgggtgaaatctccaggggataaggttgccaaaggggaaacggtggttgttgtcgag
tcagataaagcagatatggacgtagaatcgttctatgaaggctacttagccactatttta
gtcgaagctggccaagaagctcctgttggaacggcgatcgctttaattgcagaaaccgaa
gcagaaattacccaagcgcaacagcaacaaaaacccccctccgctacagcagaaccctcc
cgcgaaacgacatctcctcctgttgcttctccccaacccgtcccgacggttactgcaacc
cctactgttaccgcaagcaatgggaatggacggactgtcgcttccccacgcgcgaaaaaa
ttagccaaagaattaggagttgatctcaaaaccctgcgcggtagcggtccctacggtcgc
attgttgcaggagatgtcgaacgcgcaacaagcaaagtaaccaccgtcaccccaacccta
accccaaccccaacggttcaaccgactcctacccctagtacccctcccactcctgtccct
gcaactcctggggaaacggttcccctaacgacactacaaaaagcggtggttcagaatatg
gtagccactgtccaagtgccgacctatcatgtgggctatactatcaccacagatgcgtta
gataagctctataaacagcttaaatcgaaaggggtgactatgacagccttattagccaaa
gcggttgctatggcagtacaaaaacatcctttagtcaatgccagttatacggatcaaggc
attaaatataatgggtcaattaatgttgctttagctgtggcaatggatgatggaggactc
attacccccgtcttacaaaatgccgatcaagtcgatatttattccctctctcggacatgg
aaagatttagtcgatcgcgccagaagtaagcaattacaaccccaagaatacaacagtgga
accattacggtatcgaatttagggatgtttggggtagaccgttttgatgcgattttaccc
cccggacaaggggcaattttagcgatcggtgcatcccgtccccaagtagtagcaactccc
gatggattaattggagtacaacgtcaaatggcggtaaatattacctgcgatcatcgggtg
atttatggagcccatgcagcggcctttttacaggacttagccaaggtcattgaaaccgat
gttcaatctttaacgatgtaa

DBGET integrated database retrieval system