KEGG   Cyanothece sp. PCC 8802: Cyan8802_1261Help
Entry
Cyan8802_1261     CDS       T00968                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00010  Glycolysis / Gluconeogenesis
cyh00020  Citrate cycle (TCA cycle)
cyh00620  Pyruvate metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01130  Biosynthesis of antibiotics
cyh01200  Carbon metabolism
Module
cyh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_1261
   00020 Citrate cycle (TCA cycle)
    Cyan8802_1261
   00620 Pyruvate metabolism
    Cyan8802_1261
Enzymes [BR:cyh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cyan8802_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID: ACV00184
LinkDB All DBs
Position
complement(1282328..1283608)
Genome map
AA seq 426 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWVKSPGDKVAKGETVVVVESDKADMDVESFYEGYLATIL
VEAGQEAPVGTAIALIAETEAEITQAQQQQKPPSATAEPSRETTSPPVASPQPVPTVTAT
PTVTASNGNGRTVASPRAKKLAKELGVDLKTLRGSGPYGRIVAGDVERATSKVTTVTPTL
TPTPTVQPTPTPSTPPTPVPATPGETVPLTTLQKAVVQNMVATVQVPTYHVGYTITTDAL
DKLYKQLKSKGVTMTALLAKAVAMAVQKHPLVNASYTDQGIKYNGSINVALAVAMDDGGL
ITPVLQNADQVDIYSLSRTWKDLVDRARSKQLQPQEYNSGTITVSNLGMFGVDRFDAILP
PGQGAILAIGASRPQVVATPDGLIGVQRQMAVNITCDHRVIYGAHAAAFLQDLAKVIETD
VQSLTM
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgacatcttcatgcctgcactcagttctaccatgaccgaaggaaaaatcgtc
tcttgggtgaaatctccaggggataaggttgccaaaggggaaacggtggttgttgtcgag
tcagataaagcagatatggacgtagaatcgttctatgaaggctacttagccactatttta
gtcgaagctggccaagaagctcctgttggaacggcgatcgctttaattgcagaaaccgaa
gcagaaattacccaagcgcaacagcaacaaaaacccccctccgctacagcagaaccctcc
cgcgaaacgacatctcctcctgttgcttctccccaacccgtcccgacggttactgcaacc
cctactgttaccgcaagcaatgggaatggacggactgtcgcttccccacgcgcgaaaaaa
ttagccaaagaattaggagttgatctcaaaaccctgcgcggtagcggtccctacggtcgc
attgttgcaggagatgtcgaacgcgcaacaagcaaagtaaccaccgtcaccccaacccta
accccaaccccaacggttcaaccgactcctacccctagtacccctcccactcctgtccct
gcaactcctggggaaacggttcccctaacgacactacaaaaagcggtggttcagaatatg
gtagccactgtccaagtgccgacctatcatgtgggctatactatcaccacagatgcgtta
gataagctctataaacagcttaaatcgaaaggggtgactatgacagccttattagccaaa
gcggttgctatggcagtacaaaaacatcctttagtcaatgccagttatacggatcaaggc
attaaatataatgggtcaattaatgttgctttagctgtggcaatggatgatggaggactc
attacccccgtcttacaaaatgccgatcaagtcgatatttattccctctctcggacatgg
aaagatttagtcgatcgcgccagaagtaagcaattacaaccccaagaatacaacagtgga
accattacggtatcgaatttagggatgtttggggtagaccgttttgatgcgattttaccc
cccggacaaggggcaattttagcgatcggtgcatcccgtccccaagtagtagcaactccc
gatggattaattggagtacaacgtcaaatggcggtaaatattacctgcgatcatcgggtg
atttatggagcccatgcagcggcctttttacaggacttagccaaggtcattgaaaccgat
gttcaatctttaacgatgtaa

DBGET integrated database retrieval system