KEGG   Rippkaea orientalis PCC 8802: Cyan8802_1408
Entry
Cyan8802_1408     CDS       T00968                                 

Definition
(GenBank) 2-methylcitrate synthase/citrate synthase II
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00020  Citrate cycle (TCA cycle)
cyh00630  Glyoxylate and dicarboxylate metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
cyh01210  2-Oxocarboxylic acid metabolism
cyh01230  Biosynthesis of amino acids
Module
cyh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cyan8802_1408
   00630 Glyoxylate and dicarboxylate metabolism
    Cyan8802_1408
Enzymes [BR:cyh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Cyan8802_1408
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: ACV00326
LinkDB
Position
1439144..1440304
AA seq 386 aa
MNVCEYIPGLENIPAAKSSISYVDGQEGILEYRGIRIEELATKGSFVETAYLLIWGELPT
QEELDAFEGEIRYHRRIKYRIRDMMKCFPETGHPMDALQTSAAALGLFYARRALDNPDYI
RQAVVRLLAKIPTMVAAAHQMRRGNDPIQPNDNLDYAANFLYMMTEQKPDPLAAKIFDVC
LTLHAEHTINASTFSAMVTASTLTDPYAVVASAVGTLAGPLHGGANEEVLAMLEEIGSVE
NVRPYIEKLVANKQKIMGFGHRVYKVKDPRATILQNLAEQLFEKTGRDEYYAIAQEVEKV
VEEKLGHKGIYANVDFYSGLVYRKLGIPSDLFTPLFAIARVAGWLAHWKEQLAVNRIFRP
TQVYIGERNQPYVPMEKRLMVNRNGL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaatgtatgtgaatatatacccgggttagaaaatattcccgcggccaaatcaagtatc
agctatgtggatggtcaagagggcatactggaatatcgaggcattcgcatcgaagaacta
gcaacaaaaggtagctttgtagaaaccgcctatctcctcatttggggtgagctacccacc
caagaagaactcgatgcctttgaaggggaaattcgttaccatcgccgcatcaaataccgc
atccgtgacatgatgaagtgttttcctgaaacgggacaccccatggatgctttacaaacc
tcagcagcagcgttaggtttgttttacgcccgtcgcgccttggataacccggattatatt
cgacaagcggtcgttcgtctattagccaaaattccgacgatggtagcagcagcccatcaa
atgcgccgaggaaatgatcccattcaacccaacgataacctagattatgctgccaatttc
ctctacatgatgacggaacaaaaacctgaccccctagcagcaaaaatttttgatgtttgt
ctgacgcttcatgcggaacacaccatcaatgcgtctactttctcggccatggtaacggct
tctaccttaaccgatccctatgccgttgtcgcttcggcggtaggaaccttagccggtccc
ttacacgggggggcaaacgaggaagttttagcgatgttagaggaaattgggtcagtggaa
aatgttcgtccctacatcgaaaagttggtagccaataaacagaaaattatggggtttggc
catcgagtttataaggttaaagatcctcgcgctactattctgcaaaatttagcggaacaa
ctctttgaaaaaactggccgtgatgaatattatgccattgcccaagaagtggaaaaagtg
gtggaagaaaagttagggcataagggaatttatgctaatgtggacttctattcggggtta
gtttaccgtaagttaggcattcccagtgatttgtttacgcccttatttgcgatcgcgcgc
gtagcgggatggttagcccattggaaggaacaattagctgttaaccgtattttccgtcct
acccaagtttacatcggcgaacgcaatcagccctatgttcccatggaaaaacggctcatg
gttaaccgtaatggcttatag

DBGET integrated database retrieval system