KEGG   Cyanothece sp. PCC 8802: Cyan8802_1630Help
Entry
Cyan8802_1630     CDS       T00968                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00630  Glyoxylate and dicarboxylate metabolism
cyh00710  Carbon fixation in photosynthetic organisms
cyh01100  Metabolic pathways
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Module
cyh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cyh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cyh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cyan8802_1630
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan8802_1630
Enzymes [BR:cyh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cyan8802_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ACV00536
LinkDB All DBs
Position
1668216..1668551
Genome map
AA seq 111 aa AA seqDB search
MKTLPKERRYETLSYLPPLTDQQIVKQIEYMLDQGFIPGVEFEENPEPQTYFWTMWKLPL
FGASSSQQVLAEIRECRSEYPNSYIRVIGFDNIKQCQTMSFIVHKPNTRGY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacctaaagagcgtcgttacgaaaccctttcctatttaccccctttaacc
gatcaacaaatcgttaaacagattgagtatatgttggatcagggatttattcctggtgtg
gaatttgaagaaaatcccgaaccccagacctatttctggacaatgtggaagttaccttta
tttggtgcttcttcttctcaacaagtcttagctgaaatccgcgaatgtcgttctgagtat
cccaattcctacatccgtgtgatcggttttgacaacatcaaacaatgtcaaaccatgagc
tttattgttcacaaacctaatactcgtggatactaa

DBGET integrated database retrieval system