KEGG   Rippkaea orientalis PCC 8802: Cyan8802_1908
Entry
Cyan8802_1908     CDS       T00968                                 

Definition
(GenBank) aconitate hydratase 2
  KO
K01682  aconitate hydratase 2 / 2-methylisocitrate dehydratase [EC:4.2.1.3 4.2.1.99]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00020  Citrate cycle (TCA cycle)
cyh00630  Glyoxylate and dicarboxylate metabolism
cyh00640  Propanoate metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
cyh01210  2-Oxocarboxylic acid metabolism
cyh01230  Biosynthesis of amino acids
Module
cyh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cyan8802_1908
   00630 Glyoxylate and dicarboxylate metabolism
    Cyan8802_1908
   00640 Propanoate metabolism
    Cyan8802_1908
Enzymes [BR:cyh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     Cyan8802_1908
    4.2.1.99  2-methylisocitrate dehydratase
     Cyan8802_1908
SSDB
Motif
Pfam: Aconitase_2_N Aconitase_B_N Aconitase Ketoacyl-synt_C Arm
Other DBs
NCBI-ProteinID: ACV00801
LinkDB
Position
1934129..1936738
AA seq 869 aa
MLENYHKHAAERAKLGIPPLPLSAEQTSQLCELLKKPPEDQKEELLMLLRDRVPPGVDEA
AYVKAGFLTGIAKGEITCPLISRQDAIDLLGTMMGGYNVQSLVDLLKSSDSTLAATAATA
LSKTLLVFDVFNEVLELSETNPHAKQVIDAWSDASWFISKPKVPERIIVTVFKVPGETNT
DDLSPAPHATTRPDIPLHALVMLESKMPEGIATIARLKEKGYPVAYVGDVVGTGSSRKSA
INSVLWHIGDDIPFVPNKRAGGYILGGKIAPIFFNTAEDSGAFPIECDVSEMETGDVIII
YPYKGEITNEAGELIATFTAKPDTILDEVRAGGRIPLLIGRGLTDKTRHALGLEPSTVFV
RPSIPEDTGKGFTLAQKMVGKACGLPGVRPGTSCEPIMTTVGSQDTTGPMTRDELKELAC
LGFNADFTLQSFCHTAAYPKPVDIKTHHELPDFFSTRGGVALRPGDGIIHSWLNRMLLPD
TVGTGGDSHTRFPLGISFPAGSGLVAFAAALGVMPLDMPESVLVKFSGELQPGVTLRDIV
NAIPWVAMQQGKLTVAKENKINVFNGRIMEMEGLPDLKVEQAFELTDATAERSCAGSTIK
LGTETIAEYLRSNIALIKNMVARGYKDSRTLMRRAAKMEQWLQNPVLMEADKDAEYADII
EVNLSEIKEPIVAAPNDPDNVKLMSECAGDKVDEVFIGSCMTNIGHYRAAAKILEGAGRI
KSVLWICPPTRMDEKQLREEGVYGIFAAAGARTEMPGCSLCMGNQARVEDNATVFSTSTR
NFNNRMGKGARVYLGSAELAAVCALLGKIPTVEEYMAIVTEKIDPFAGELYRYLNFNEIE
GFEEEGRVIPLEEMPKIEDILGIPAGVLS
NT seq 2610 nt   +upstreamnt  +downstreamnt
atgttagaaaactatcataaacacgcagcagaaagagcaaaacttggcatccctccctta
cccttaagcgcagaacaaacctcccaactctgtgaactgttaaaaaaacccccagaagac
caaaaagaagaacttttgatgttattacgcgatagagttccccctggtgtagatgaagca
gcttatgttaaagcagggtttttaacgggtattgccaagggtgagataacctgtcccctt
atttcccgtcaagacgcgatagacttattagggacgatgatgggcggttataatgtacaa
tcgttggtagatctcctcaaatcttccgatagcaccctcgcagcaaccgcagcaaccgca
ttaagcaaaactctgttagtctttgatgtcttcaatgaggttttagaactctccgaaacc
aacccccacgcaaaacaagtcattgacgcatggtctgacgcttcttggttcattagtaaa
cccaaagtacccgaacgcatcatcgtcaccgtctttaaagtccctggagaaactaataca
gacgacctatctcctgctccccatgcaaccactagacccgatattcccctccatgcgttg
gtgatgttagagtcaaaaatgccagaaggcatcgcaaccattgccagactcaaagaaaag
ggctatcctgtagcctacgttggggatgtagtggggacaggttcctcccgtaaatcagcg
attaactcagttttatggcacattggcgatgatattccctttgttcccaataaacgcgca
ggaggttacattttaggcggaaaaattgcccctattttctttaatacagcagaggactct
ggtgcattccctatcgaatgcgatgtcagtgagatggaaacgggagacgttatcatcatc
tatccctacaaaggagagataaccaacgaagcaggagaattaatcgctactttcaccgca
aaacctgacactattctagacgaagttcgcgcagggggacgcattcccctactcattgga
cgcgggttaaccgataaaacccgtcatgcgttaggactcgaacctagcactgtttttgtt
cgtcctagtattcctgaagatacgggtaaaggctttactttagcacaaaaaatggtcgga
aaagcttgtggtttacctggggtcagacctggaacctcttgcgaacccatcatgactact
gttggttcccaagataccaccggaccgatgacccgtgatgaattaaaagaactcgcttgt
ttagggtttaatgcagacttcaccctccaaagtttctgtcatactgctgcgtatcccaaa
cccgtagacatcaaaacccatcacgagttaccggacttcttttcgactcgtgggggggtt
gccttgcgtcctggggatggtatcattcactcctggttaaaccggatgttattacccgat
acggtagggacagggggtgactcccatactcgtttccccttggggatatctttccccgca
ggttccggtttagtcgcatttgccgcagcattaggggtgatgcccttagatatgccagaa
tcagtgttagttaagtttagtggggaattgcaacctggagtaaccttacgcgatattgtt
aatgctattccttgggtagctatgcagcaaggtaaattaactgttgctaaagagaacaaa
attaatgtttttaatggccgtattatggagatggaaggtttaccagatttaaaagttgaa
caggcttttgaattaacggatgcaacggcagaacggtcctgtgcagggtcaactattaag
ttaggaacagagactattgctgaatatttgcggtcaaatattgccctcattaaaaatatg
gtagcgcggggatataaagattctcgaaccttgatgcgtcgtgcggctaaaatggaacaa
tggttacaaaatcctgtgttgatggaagcggataaagatgcagaatatgctgatattatt
gaagtcaatttaagcgagatcaaagaaccgattgtggctgcacccaatgaccctgataat
gttaaattaatgtccgaatgtgcaggggacaaagtagatgaagtgttcatcggttcttgt
atgaccaatattggtcattaccgcgcggctgctaaaattttagagggtgcaggccgtatt
aaatctgttttgtggatatgtccccctacccgaatggatgaaaaacagctacgggaagag
ggggtttatggcatttttgcggctgcgggtgccagaacagaaatgcctggatgttcccta
tgtatgggcaaccaagcaagggtagaagacaatgcaacggtcttttctacctctacccgt
aactttaacaatcgtatgggtaaaggtgcaagggtttacctcggttctgctgaattagct
gcggtgtgtgccttattaggaaaaatccccactgttgaggaatatatggctattgttacc
gaaaaaattgatccttttgcaggtgaattgtaccgttatttaaacttcaatgaaattgaa
ggatttgaagaagaaggacgggttattcccttagaagaaatgccgaagattgaggatatt
ttaggcattcctgcgggagttttaagctaa

DBGET integrated database retrieval system