KEGG   Cyanothece sp. PCC 8802: Cyan8802_2181Help
Entry
Cyan8802_2181     CDS       T00968                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cyan8802_2181
Enzymes [BR:cyh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Cyan8802_2181
Transporters [BR:cyh02000]
 Other Transporters
  Pores ion channels [TC:1]
   Cyan8802_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C_5 GST_N_4 GST_N Glutaredoxin GST_C
Motif
Other DBs
NCBI-ProteinID: ACV01068
LinkDB All DBs
Position
complement(2186943..2188148)
Genome map
AA seq 401 aa AA seqDB search
MTLPLSWSELESLADFPRDFINGPTNAHARLRLFGRSESEVRVILYRDHHAWCPYCQKVW
LWLEEKQIPYRIEKVTMFCYGTKESWYKRKVPSGMLPALELDGRLITESDDILLSLESVF
GPLTQSMSDRRVIPLRQLERSLFRAWCSWLCRSNAQEQRNREQFITIVEKVEEALSQTPG
PYFLEEFGTVDVIFTPYVERMNASLYYYKGYSLREENPRLAAWFDGMESRQTYRGTQSDF
HTHAHDLPPQMGGCYENGTPQMLINKARVDHGPWLGLPDVSYPEPKTSRTEALQRVMKHR
DNLIRINPADDQLFDIALRCALTKMMTDQICLPPQGSDLGLRYLRDRISVPRDMSIYAAK
RLRQALEETASLVGDQQGTPIPVNHRRDQDPAQFAKALKQA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacactcccgctatcgtggtctgaattagagtccttagccgattttccgagagatttt
atcaatggaccaacgaatgctcacgcccgtttgcgcctatttggtcgtagtgaatcagag
gttcgagtcatcctctaccgcgatcaccatgcttggtgtccctactgtcaaaaagtctgg
ctgtggcttgaggaaaaacaaatcccttaccgcatcgaaaaagtcactatgttctgttat
gggacaaaagagagttggtacaagcgaaaagtcccttctgggatgctccctgcccttgag
ctagatggccgtctgattaccgaaagtgatgacattttactgtccttagaaagcgttttt
ggtccattaacccaatcaatgagcgatcgccgggtgatccccctacgacaattagagcga
tcgctatttcgggcttggtgttcctggctgtgtcgttctaacgcccaagaacagcgcaac
cgggagcaatttatcactatcgtggaaaaagtcgaagaagccctaagtcagacccctgga
ccctattttctcgaagaatttggcacagttgatgtcatctttacgccctatgtcgaacgg
atgaacgccagtctctattactacaaaggctattccttgcgggaagaaaacccccgttta
gcagcttggtttgatggcatggaaagccgacagacctatcggggaacccaaagtgatttt
catacccacgcccacgatctcccgccgcagatgggaggatgctacgaaaatgggacacct
cagatgttaattaataaagccagggttgatcatggaccgtggttgggactaccggatgtg
agttacccagaaccaaaaacctcgcgtactgaagccctccaacgggtgatgaaacaccgt
gacaacctcatccgcattaatccagccgatgatcagttgtttgatattgccctgcgttgt
gccttaaccaagatgatgacagaccaaatctgtttacccccccaagggtctgatctcggt
ctacgctatttacgcgatcgcattagtgttcctagggatatgtctatctatgctgccaaa
aggttgcgccaagcccttgaagaaacggcctctctagtcggggatcagcaagggactccc
attcctgtaaaccatcgacgggatcaagacccggctcagtttgcgaaggcactcaaacaa
gcttga

DBGET integrated database retrieval system