KEGG   Cyanothece sp. PCC 8802: Cyan8802_2763Help
Entry
Cyan8802_2763     CDS       T00968                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cyh  Cyanothece sp. PCC 8802
Pathway
cyh00473  D-Alanine metabolism
cyh00550  Peptidoglycan biosynthesis
cyh01100  Metabolic pathways
cyh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cyh00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Cyan8802_2763
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cyan8802_2763
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Cyan8802_2763
Enzymes [BR:cyh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Cyan8802_2763
Peptidoglycan biosynthesis and degradation proteins [BR:cyh01011]
 Precursor biosynthesis
  Amino acid ligase
   Cyan8802_2763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACV01618
LinkDB All DBs
Position
2788446..2789501
Genome map
AA seq 351 aa AA seqDB search
MAKLRVGLLFGGRSGEHEVSLNSARAIATALQSGENPQKYDIIPIYIQKNGVWQAGETAQ
QVLNDAKPLPCEDATSQQLWTFPPQVSEVDVWFPILHGPNGEDGTLQGLLTLMQTPFVGS
GVLGSAVGMDKIAMKMAFAQAGLPQVKYIAVDRAQIWSNPCVFPKLCDEIEQGLGYPCFV
KPANLGSSVGIAKVRSRSELEKALDSAASYDRRIVIETGVKAREVECAVLGNENPKASVI
GEITYNSDFYDYEAKYTDGMAQMQIPAQLPDAIVTQIQDMAIQAFKAVDGAGLARVDFFY
VEDSQEVFINEINTLPGFTAFSMYPQLWKETGVPFAELVDQLIQLALERKQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattacgggtagggttactgttcgggggacgttcgggagaacacgaggtgtct
cttaattctgctagagcgatcgcaacggctttacaatcgggtgaaaatccccaaaaatat
gatataataccgatttatatccaaaaaaacggcgtttggcaagctggagagaccgcgcaa
caagtcctcaacgatgcaaaacctttaccttgtgaggatgcaacctcgcaacaactctgg
acattccctccccaagtcagtgaggtggatgtttggtttcccattcttcacggtcccaat
ggagaagacggaactttgcaagggttattaaccctaatgcagactccctttgtgggcagt
ggtgtgttaggatcagccgtaggcatggataagattgccatgaaaatggcctttgctcag
gcaggattacctcaagttaagtatatcgcggtagatagagcgcaaatttggtctaatccc
tgtgtttttcccaagctttgcgatgagattgaacaagggttaggctatccgtgttttgtt
aaacccgctaacttaggatcatcggtgggaattgctaaagtgcgatcgcgttctgaatta
gaaaaggctttagatagtgcagcgagttacgatagacgcattgttatcgaaacaggagtc
aaagcgcgagaggtagaatgtgctgttttaggcaatgaaaacccgaaagcgtcggttatt
ggcgaaatcacctacaatagtgatttctatgactacgaggcaaaatataccgatgggatg
gctcaaatgcaaattcccgcgcaattgcctgatgcgattgtaacccaaattcaagacatg
gctatccaagcgtttaaggcggtagacggggcaggattagctagggtagactttttctat
gtcgaagatagccaagaagtgtttatcaatgaaattaatacccttccagggttcactgcg
tttagtatgtatccccaactttggaaagaaacgggggttcctttcgcggaattggttgat
caattaattcaattagcgttagaaagaaaacaatag

DBGET integrated database retrieval system