KEGG   Rippkaea orientalis PCC 8802: Cyan8802_2918
Entry
Cyan8802_2918     CDS       T00968                                 

Definition
(GenBank) fumarate hydratase, class II
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00020  Citrate cycle (TCA cycle)
cyh00620  Pyruvate metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cyan8802_2918
   00620 Pyruvate metabolism
    Cyan8802_2918
Enzymes [BR:cyh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     Cyan8802_2918
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C Heliorhodopsin
Other DBs
NCBI-ProteinID: ACV01766
LinkDB
Position
2954612..2956006
AA seq 464 aa
MRTETDSMGPIDVPDNCYWGAQTQRSLHYFAIGEDIMPPEMIRAIGILKKAAAIVNCDLG
KLPPDQAELIIKAADEVIRGELDDHFPLSIWQTGSGTQTNMNANEVIANRAIELAGGILG
SKEPIHPNDHVNMSQSSNDTFPTAMHIAAVEEIHHHLLPMLTKLIDALAAKQEQFNHIVK
IGRTHLMDAVPLTLGQEFSGYVSQLEKNRDRLYQILPDLCELAIGGTAVGTGLNTHPQFA
QRMAKEIAKLTDFPFVCATNKFAALASHDAIVMASGALKTLAASLMKIANDIRWLGSGPR
CGLGELILPANEPGSSIMPGKVNPTQCEAMTMVCAQVMGNDTAINIAGSQGNFELNVFKP
MMIFNLLNSIELLGDACSSFTDHLVVGLEPNREQIEYYLTNSLMLVTALNPHLGYDRAAQ
VAKKAYTDKTSLQQACVELGFLTAEEFNFLVRPEAMARPFENEL
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgcgaactgaaaccgacagcatgggacccattgatgtacctgataattgttattgggga
gcacagacacagcgatcgctccattattttgccattggtgaagatattatgccccccgaa
atgattcgggcgatcggtatcctaaaaaaagccgccgcgatcgttaattgtgatttagga
aaattgcctcctgatcaagcagaactcatcataaaagcagccgatgaagtgattagggga
gagctagatgatcactttcctctgagtatttggcaaacgggaagtggcactcaaactaat
atgaatgctaatgaagtgatcgctaaccgagccattgaattagcggggggaatattggga
agtaaagagcccattcatcccaatgatcatgtcaatatgtctcaatcttctaatgatact
tttcccacggcaatgcacatcgctgcggtagaagaaattcaccatcatttattaccgatg
ctgacgaagttaattgatgctttggcagctaaacaagagcagtttaatcatattgttaaa
attggtagaactcacctcatggacgcagttccgttgacgttaggacaggaattttcaggg
tatgtttctcaactggaaaaaaaccgcgatcgcctctaccaaattttacccgatctgtgt
gaattagccatcggcggaacggctgttggaacagggttaaatacccatccccagtttgcg
caacggatggctaaagagatagctaaactaacagatttcccctttgtttgtgctactaat
aaatttgccgctttagcctcccatgatgcaattgttatggccagtggtgcgcttaaaacc
ttggctgcttctttgatgaaaattgctaatgatattcgctggttgggatcgggaccccgt
tgtgggttaggagagttaattttacccgctaatgaacccggatcttcaattatgccaggt
aaagttaatccgacgcaatgtgaagctatgaccatggtttgtgctcaggtgatggggaat
gatacggcgattaatattgcgggaagtcaaggcaattttgagcttaatgtttttaaacca
atgatgatttttaatttgcttaattccattgaattattaggcgatgcttgttcttctttt
accgatcatttagtcgtgggacttgaacccaatcgagaacaaattgaatattacttgacg
aattctttgatgttagtgactgctttgaacccccatcttggctatgatcgtgctgcccaa
gttgctaaaaaagcttatactgataaaaccagtctacaacaggcttgtgttgagttaggt
tttctcactgctgaggaatttaacttcttagttcgtcctgaagctatggctcgtcccttt
gagaatgaactgtaa

DBGET integrated database retrieval system