KEGG   Rippkaea orientalis PCC 8802: Cyan8802_3213
Entry
Cyan8802_3213     CDS       T00968                                 

Definition
(GenBank) Transketolase central region
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00010  Glycolysis / Gluconeogenesis
cyh00020  Citrate cycle (TCA cycle)
cyh00620  Pyruvate metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Module
cyh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_3213
   00020 Citrate cycle (TCA cycle)
    Cyan8802_3213
   00620 Pyruvate metabolism
    Cyan8802_3213
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Cyan8802_3213
SSDB
Motif
Pfam: Transket_pyr Transketolase_C Flu_NP
Other DBs
NCBI-ProteinID: ACV02051
LinkDB
Position
complement(3286683..3287666)
AA seq 327 aa
MAETLLFNALRQAIDEEMAHDETVFVLGEDVGHYGGSYKVTKDLYKKYGDLRVLDTPIAE
NSFTGMAVGAAMTGLRPIIEGMNMGFLLLAFNQIANNAGMLRYTSGGNFKIPMVIRGPGG
VGRQLGAEHSQRLEAYFHAVPGLKIVACSTPYNAKGLLKAAIRDDNPVLFFEHVLLYNLK
EKLPDTEYIVPLDKAEIVRPGKDVTILTYSRMRHHCVQALKTLEKEGYDPEIIDLISLKP
FDLETIGASIRKTHRVIIVEECMKTGGIAAELIALINDNFFDELDAPVIRLSSQDIPTPY
NGTLENLTIVQPAKIVEAVQKMVALRV
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcagaaaccttattatttaatgcactccgtcaagccattgatgaagaaatggctcat
gacgagacagtttttgttctcggagaagacgtaggacactacggcggttcctacaaggta
acaaaagatctttacaaaaaatacggcgacctacgggttctcgatacccccatcgctgaa
aacagctttacgggaatggcggtaggggctgccatgacaggattacgtcctattattgaa
gggatgaacatggggtttttactcctcgcgtttaaccaaattgctaacaatgcggggatg
ctacgctatacctctgggggcaacttcaaaataccgatggtgattcgcggtccagggggc
gtaggacggcaattaggggctgaacactcccaacgccttgaagcctatttccatgctgtt
cctgggctaaaaatcgtggcctgttccactccttacaacgccaagggactcctcaaagca
gctatccgcgatgataaccccgttctctttttcgagcacgttcttctctacaatttgaag
gaaaaattgcccgatacggaatacattgttcccttagataaagcagaaatcgtcagacca
gggaaagatgttactatcctgacctattcacggatgcgccatcattgtgttcaggcgtta
aaaaccttagaaaaagaagggtatgaccccgaaattatcgatttaatttctttaaaaccc
tttgatttagagacaattggtgcatctattcggaaaacccatcgggtgattattgtagaa
gaatgtatgaaaaccgggggaattgccgccgaattaattgcgctgattaatgataatttc
tttgatgaattggatgccccagttattcgcttatcctcccaagatattcccactccttat
aacggaacattagaaaatttgaccattgttcaaccggctaaaattgttgaagcagtccag
aaaatggtagctttgcgggtttag

KEGG   Rippkaea orientalis PCC 8802: Cyan8802_4191
Entry
Cyan8802_4191     CDS       T00968                                 

Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00010  Glycolysis / Gluconeogenesis
cyh00020  Citrate cycle (TCA cycle)
cyh00620  Pyruvate metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Module
cyh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_4191
   00020 Citrate cycle (TCA cycle)
    Cyan8802_4191
   00620 Pyruvate metabolism
    Cyan8802_4191
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Cyan8802_4191
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N
Other DBs
NCBI-ProteinID: ACV02983
LinkDB
Position
4318155..4319189
AA seq 344 aa
MVSERTLPQFNTATVNITKEEGLLLYEDMMLGRLFEDKCAEMYYRGRMFGFVHLYNGQEA
ISTGIIKALRSGEDYVSSTYRDHVHALSCGVPAREVMAELFGKETGCSKGRGGSMHLFSA
QHRLLGGYAFVAEGIPVAMGAAFQSKYRREAMGDPNADQVTVCFFGDGASNNGQFFECLN
MSALWKLPIIYVVENNKWAIGMAHDRATSQPEIYKKASVFSMAGVEVDGMDVLAVRSVAQ
EAIARARAGEGPTLIEALTYRFRGHSLADPDELRAPDEKQFWGARDPITKLATYLVEHNL
ANSQELKDIEKRVQETINEAVQFAENSPEPDPSELYRYIFAEDE
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggtttctgaacgcactttaccccaatttaacaccgctacggtcaacattacgaaagag
gaaggactcctcctctacgaagatatgatgctcggacgcttgtttgaagacaagtgtgct
gaaatgtattaccgaggtcggatgtttgggtttgtccatctctacaacggacaagaagct
atctcgacggggatcattaaagcgttgcgttctggggaagattatgtgtcgagtacctat
cgagatcacgtccatgccctcagttgtggggttcctgcgcgggaagtcatggcagaattg
ttcgggaaagagactggatgcagtaaaggacggggtggctcgatgcacctgttttctgct
caacatcgactgttaggcggttatgcttttgtggctgaaggtatccccgtagccatgggg
gcagcctttcaaagtaaatatcgacgggaagccatgggtgatcccaatgcagatcaagtg
acggtctgtttcttcggggatggggccagcaataacggtcaattctttgagtgtctgaat
atgtcggctctgtggaaattaccgattatttatgtggtagaaaataataaatgggcgatc
ggcatggctcatgatcgcgcgacttctcaaccagaaatctacaaaaaagccagtgttttt
agtatggccggggttgaagttgatgggatggatgttttagccgttcgttctgtggctcaa
gaagcgatcgctagagcccgcgcaggggagggtccaaccttaattgaagcccttacctat
cggtttcggggtcactccttggctgatcctgatgaactacgagcccctgatgaaaagcaa
ttttggggagcgcgtgatcccattactaagttagcgacctatttagttgaacacaatttg
gctaatagtcaagaactcaaagatatcgaaaaacgagtgcaagaaaccattaatgaagcg
gtgcaatttgctgaaaacagtccagaacccgatcctagtgaactttatcgctatattttt
gctgaggatgaataa

DBGET integrated database retrieval system