KEGG   Rippkaea orientalis PCC 8802: Cyan8802_3966
Entry
Cyan8802_3966     CDS       T00968                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase
  KO
K03737  pyruvate-ferredoxin/flavodoxin oxidoreductase [EC:1.2.7.1 1.2.7.-]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00010  Glycolysis / Gluconeogenesis
cyh00020  Citrate cycle (TCA cycle)
cyh00620  Pyruvate metabolism
cyh00650  Butanoate metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Module
cyh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_3966
   00020 Citrate cycle (TCA cycle)
    Cyan8802_3966
   00620 Pyruvate metabolism
    Cyan8802_3966
   00650 Butanoate metabolism
    Cyan8802_3966
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Cyan8802_3966
    1.2.7.-  
     Cyan8802_3966
SSDB
Motif
Pfam: POR_N POR EKR PFOR_II Fer4_16 Fer4_7 Fer4 Fer4_9 Fer4_6 Fer4_10 Fer4_2 TPP_enzyme_C Fer4_21 Fer4_8 Fer4_18 Fer4_4 Fer4_17 Fer4_13 Transketolase_C Fer4_22
Other DBs
NCBI-ProteinID: ACV02769
LinkDB
Position
complement(4079962..4083600)
AA seq 1212 aa
MNAKTYATIDGNEAVARVAYRLNEVIAIYPITPSSPMGEWADAWCSEGRTNLWGTVPSIV
EMQSEGGAAGAIHGSLQTGALTTTFTASQGLLLMIPNLYKIAGELTATVIHVAARSLAAQ
GLSIFGDHGDVMAARSTGFALISSASVQEAQDLAAITTAASFESRVPGMHFFDGFRTSHE
VQKVELLDDSVLRSLIQDEWVIAHRDRALTPDRPVIRGTAQNPDVYFQARETVSPFYTAY
PEILQKAMDKFAQLTGRQYHLFDYHGHPEAERVIILMGSGCETVQETVDYLLSQGEKVGV
LKVRLYRPFEATKLIEALPKTVKKIAVLDRTKEPGSAGEPLYLDVVTSFVEAFHEMPLPK
IVGGRYGLSSKEFTSAMVKGIFDNLTLDNPKNHFTIGIKDDVSHTSINYDPNFSTEPDNV
VRAIFYGLGSDGTVGANKNSIKIIGEETNNYAQGYFVYDSKKSGSVTVSHLRFGPNPIQS
TYLVTKANFIACHQWEFVEKFDLLESAIDGSTLLLNSPYKPEEIWHHFPRSMQEQMINKH
LKVYTINAYEVAKNAGMGGRINTVMQVCFFALSGVLPRDEAIEQIKKAIRKTYGKKGEEI
VQMNMKAVDASLDHLHEITIPTAVDKDASEISHPIPDRAPAFVRDVLGKMLARQGDEIPV
SALPCDGTYPSGTAKWEKRNVTQEIPVWDPDVCVQCGKCVLVCPHAVIRSKVYEETALVN
APETFKTASAKDLDWKKTQLKFTIQVAAEDCTGCGVCVDVCPAKNKSQPKLKAINMAPQL
PIRDQERENWDYFLSIANPDRNTLKLNKISHQQMQEPLFEFSGACAGCGETPYIKLATQL
FGDRMVVANATGCSSIYGGNLPTTPWSYNQEGRGPAWSNSLFEDNAEFGLGFRVSIDKQA
EFAAELLKSLASEVGDSLATAILTTQQTDEADIFEQREQVAILKQRLAELSNSNLDDSIQ
AKVTMLKSLADYLVKKSVWIIGGDGWAYDIGYGGLDHVLASGRNVNILVMDTEVYSNTGG
QASKATPRAAVAKFAAGGKASPKKDLGLMAMTYGNVYVASVAMGAKNEQTIKAFLEAEAY
QGVSLIIAYSHCIAHGINMTTAMSYQKEIVDSGRWLLYRYHPDLILQGKNPLQLDMGRPK
LPIEQTMYQENRFKMLARSKPDAAKKLLKEAQEDVNTRWKMYQYLAVRQLETGNGNGHSK
ATVQSETSVSEV
NT seq 3639 nt   +upstreamnt  +downstreamnt
atgaacgccaaaacctacgctactattgatggaaacgaagccgttgctagagttgcttat
cgcctcaatgaagtgatcgccatctatcccattaccccctcctcacccatgggagaatgg
gctgacgcttggtgctcagaaggacggacgaacctgtggggaacagtcccctctattgtc
gaaatgcaaagcgagggaggggcagcaggagcaatacacggatctttgcaaacaggggcg
ttaacaaccacgtttaccgcctctcagggcttattattgatgattcccaacctctacaag
atagcgggagaactgacggcaaccgtcatccacgttgccgcgcgatcgctggctgcccaa
gggttgtctattttcggggatcacggggatgtcatggccgcccgtagtaccgggtttgcg
ttgatcagttctgcatccgtgcaagaagcgcaggatctcgcagccattactacagccgcc
agttttgagtcgagagtccctggaatgcacttttttgacggttttcggacttcccacgaa
gtgcagaaggtggagttattggacgatagtgtgttgcgatcgctgatccaagatgaatgg
gtcattgcccaccgcgatcgcgctttaacccctgatcgccccgtgattcgaggtactgct
caaaaccccgatgtttacttccaggctagagaaacagttagcccattttatacagcttat
cccgaaattctgcaaaaagcaatggataagtttgctcaactgacgggacgacaatatcac
ctctttgattatcatggtcatcctgaagctgaacgggtcattattttgatgggttccggt
tgtgagacagtccaggaaaccgtagattatctattaagtcaaggggaaaaagttggagtc
ctaaaagttcgtttataccgtccctttgaagccacaaaattaattgaagctttacctaaa
accgtcaaaaaaatagctgttctagatcgaacgaaagaaccaggatcagccggagaaccc
ttatatttagatgttgttacgtcctttgttgaggcatttcatgaaatgcccctcccgaaa
attgtcggaggacgctatgggttatcctctaaagaatttacctccgcaatggtcaaagga
atctttgataaccttactttagataatcctaaaaatcactttactattggtataaaggac
gatgttagccatacaagtattaattacgatcctaacttttctactgaacctgataacgtc
gttcgcgctattttctatggcttaggatcagatggaacggtgggagccaacaaaaactct
attaaaattattggggaagaaaccaataattatgcccaaggttactttgtttatgactcg
aaaaaatcgggttctgttaccgtttctcatcttcgttttggtcctaaccctattcagtct
acttacttagtaactaaagccaattttatcgcttgtcatcaatgggagtttgtcgaaaaa
ttcgatttattagaatctgccattgatggatcaaccttattacttaatagtccctacaaa
cccgaagaaatttggcatcatttcccccgttccatgcaggaacaaatgattaataaacac
ctcaaagtctataccatcaacgcttacgaagtcgccaaaaatgcaggaatgggaggacgg
ataaacaccgttatgcaagtgtgcttctttgccctatcaggggtattaccgagagatgaa
gcgatagaacagattaaaaaggctattcgtaagacttacggtaaaaaaggcgaagaaatc
gttcaaatgaacatgaaagcggttgacgcatccctagatcatctccatgaaataacgata
ccgactgcggtagataaagatgccagcgagatcagtcatcccattcctgacagagccccc
gcattcgttcgggatgttctaggaaaaatgctggcccgtcagggagacgagatccccgtt
agtgctttaccgtgcgatggaacctaccccagtgggacagcaaaatgggaaaaacgcaac
gtcacccaagagatacccgtttgggacccagatgtctgcgttcaatgtggtaaatgtgta
ttagtttgtcctcatgcggtcatccgatccaaagtttacgaagaaactgccttagttaat
gcacctgaaaccttcaaaaccgcgtcagcaaaggatctcgactggaagaaaacccaatta
aaattcaccatccaagtcgctgcggaagactgtaccggatgcggggtttgcgtcgatgtt
tgtccagctaaaaacaaatctcaacccaaactcaaagctatcaatatggccccgcagttg
ccaatacgggaccaagaacgggaaaattgggactatttcctctctattgctaaccccgat
cgcaataccctaaaattgaataaaattagccatcaacagatgcaagaaccgttattcgag
ttctctggtgcttgtgcaggatgtggcgaaaccccctatattaaattagcgactcaatta
ttcggcgatcgcatggtagtcgctaatgcaacgggatgttcttctatttacgggggaaac
cttcctactactccttggtcatataaccaagaaggacgcggacccgcttggtcaaactct
ctgtttgaagataatgctgaatttgggttagggtttcgggtttccatcgataaacaagca
gagtttgcagcagaactgcttaaaagtcttgctagtgaagtcggagacagtttagctact
gctatcttaaccacgcagcaaaccgacgaagcagacatctttgaacaacgggaacaagta
gctatcctgaagcaacggttagcagaattaagcaatagtaacctagacgattcaattcag
gcaaaagtaaccatgttaaagtcgttagccgactatttggttaaaaagagtgtctggatt
attgggggtgacggttgggcttatgatattggttacggtgggttagatcacgtcttagcc
agtggtcgcaacgtcaacattttggtcatggatacggaagtttattctaacacgggggga
caagcctccaaagccactcctcgcgctgctgtagcgaaatttgccgcaggggggaaagcg
tcacccaagaaagacttagggttaatggctatgacctatggtaacgtctatgtagcgagt
gtggctatgggtgctaaaaatgagcagactatcaaagcattcctagaagcagaagcttat
caaggagtctcattaattatcgcctattctcattgtattgctcatggtattaatatgacc
acagccatgagttatcaaaaagaaattgtagacagtggacggtggttattgtatcgctat
catcccgatttaatcctacaaggaaagaaccccttacagttagatatgggtcgtcctaag
cttcccattgaacagacgatgtatcaagaaaaccgcttcaaaatgttagcaagaagtaaa
cccgatgcagccaaaaaactgctgaaagaagcgcaagaggatgttaatacccgttggaaa
atgtatcaatatttagctgtaagacagttagaaacaggtaacgggaatggacatagtaaa
gcaactgttcaatctgaaacatcagtcagtgaagtttag

DBGET integrated database retrieval system