KEGG   Rippkaea orientalis PCC 8802: Cyan8802_4014
Entry
Cyan8802_4014     CDS       T00968                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00020  Citrate cycle (TCA cycle)
cyh00480  Glutathione metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
cyh01210  2-Oxocarboxylic acid metabolism
cyh01230  Biosynthesis of amino acids
Module
cyh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cyan8802_4014
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Cyan8802_4014
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Cyan8802_4014
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-ProteinID: ACV02813
LinkDB
Position
complement(4129517..4130944)
AA seq 475 aa
MYEKLTPPSTGSKITFKDGKPIVPDDPIIPFIRGDGTGVDIWPATEKVIDAAVAAAYGGQ
RKINWFKVYAGDEACDLYGTYQYLPDDTLKAIEEYGIAIKGPLTTPIGGGIRSLNVALRQ
IFTLYACVRPCRYYAGTPSPHKSPEKLDVIVYRENTEDIYLGIEWREGSEIGQKLIKYLN
DELIPATPEHGKKRIPLDAGIGVKPISKTGSQRLVRRAMEHALRLPKAKQMVTLVHKGNI
MKYTEGAFRDWGYELATTEFRDVCVTERESWILSNKEGNPNISIEDNARKVEPGYDALTP
EKKKEACDEVKSVLDAIWDSHGDGKWKDKIMVNDRIADSIFQQIQTRPDEYSILATMNLN
GDYLSDAAAAVVGGLGMGPGANIGDTCAIFEATHGTAPKHAGLDRINPGSVILSGVMMLE
YMGWQEAADLIKKGLGNAIANREVTYDLARLMEPPVDPPLKCSEFAQAIINHFAD
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgtacgaaaaactaacccctccctccactggttctaaaattacctttaaagacggtaaa
cctattgttcccgatgatcccatcattcccttcatccgtggcgatggaacaggggtagat
atctggcctgctactgaaaaagtcatcgatgctgctgttgctgctgcttacggaggtcaa
cgcaaaattaactggtttaaggtctatgcaggggatgaagcttgcgatctctacggaact
tatcaatacttacccgatgataccctaaaagcgatcgaagaatatggtattgccatcaaa
ggacccttaacgacccctatcggtggtggtattcggtcattaaacgtcgcgttacggcaa
attttcaccctctatgcttgcgttcgtccctgtcgttactatgcgggaaccccttccccc
cacaagtcccccgaaaaactcgatgtcatcgtctatcgggagaataccgaggatatctat
ctgggaattgaatggcgagaaggcagcgaaattgggcaaaaattgattaaatacctcaat
gatgagttaattcccgccactcctgaacacggcaaaaaacgcatccctctagacgcagga
attggggttaaacccatcagtaaaacgggttcccaacggttagttcgtcgcgcaatggaa
cacgctttacgtctccctaaagcgaagcaaatggtgacgttagtccacaaagggaatatc
atgaaatataccgagggagcgtttcgagattgggggtatgaactcgctaccacagaattt
cgggatgtctgcgttacggaacgagaatcttggattttgagtaataaagagggtaatcct
aatattagtatcgaagataatgcccgtaaagtcgagcctggttacgatgcgctgacccct
gagaagaaaaaagaagcctgtgacgaagttaaatcggttttagatgctatttgggatagt
cacggggatggtaaatggaaggataagatcatggtgaacgatcgcattgctgatagtatc
ttccaacaaattcaaacccgtcctgatgaatattctatccttgctaccatgaacctgaac
ggggactatctctctgatgctgctgctgcggtggttggtggtttaggaatgggacctggt
gccaatattggggatacctgtgctatttttgaggctacccacggaactgcgccaaaacac
gcgggtttagaccgtattaacccgggttcggtgattttatcgggggtaatgatgttagag
tatatgggatggcaagaagcagccgatttgattaaaaaaggcttgggaaatgcgatcgct
aatcgggaagtaacgtacgatttagcgcggttgatggaacctcctgtcgatcctcccttg
aaatgttccgagtttgcacaagccattatcaatcattttgcggattag

DBGET integrated database retrieval system