KEGG   Rippkaea orientalis PCC 8802: Cyan8802_4079
Entry
Cyan8802_4079     CDS       T00968                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00010  Glycolysis / Gluconeogenesis
cyh00020  Citrate cycle (TCA cycle)
cyh00620  Pyruvate metabolism
cyh00710  Carbon fixation in photosynthetic organisms
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
Module
cyh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_4079
   00020 Citrate cycle (TCA cycle)
    Cyan8802_4079
   00620 Pyruvate metabolism
    Cyan8802_4079
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan8802_4079
Enzymes [BR:cyh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Cyan8802_4079
SSDB
Motif
Pfam: PEPCK_ATP
Other DBs
NCBI-ProteinID: ACV02875
LinkDB
Position
4203541..4205256
AA seq 571 aa
MVNLNLYGDSSAQNPLKIPPHLSQGLDYPKVHPSSVTTSDREDGIKFPTYGLETLGIHNV
SWVYRNLPVAELVEHAVRRGEGILADNGALVVETGKYTGRSPNDRYIVDEPTTRHEIDWN
HHNVAISERQFEQLYQRVLSYVQGRELYIFDGYVGADRNYRHGVRVINELASQNLFVHQL
FLRPSPEELANHQADFTVIAVPGLHGDPEIDGLRSEAFIVLHLTKRLVIIGGSRYSGEMK
KSVFSMMNYVIAKENVLPMHCAANIDKRAHTTLFFGLSGTGKTTLSADPDCSLIGDDEHG
WSKDGIFNFEGGCYAKTIRLSQENEPQIWAALQFGTLLENVIFDPETRTPDYDDSRLTEN
TRAAYPLHYIPNCSLWGIGSHPKTIFLLTADAFGVLPPIAKLTKQQAMYHFLSGYTSKLA
GTERDVTSPKVTFSACFGQCFFPLSPIVYARMLGERLEQHNDTQVFLLNTGWSGGSYGVG
HRIPIKHTRAMVAAALNGHLEKANYHPHPIFKVLVPDHIAGVPNKILDPQNTWDDPEAYQ
QQALDLAHRFMENFRQFHNVPPEIAQAGPVC
NT seq 1716 nt   +upstreamnt  +downstreamnt
atggtcaaccttaatttatatggtgatagttctgcccaaaaccccctcaaaattcctccc
catctttcccagggattagactatccaaaagtccacccttcctcagtaacgacaagcgat
cgcgaagatggaatcaaattcccgacctatggcctagaaaccttaggcattcataatgtg
agttgggtctatcgcaatcttcccgtcgctgaattggtggaacacgctgtcagacgaggc
gaggggattttagcggataacggggcgttagtcgttgaaacaggcaaatatactggacgt
tcccccaacgatcgctacattgttgatgagcccaccacccgtcacgaaatcgactggaat
caccacaacgtcgccatttctgaacgacaatttgaacaactctatcaacgggtcttatcc
tacgttcaagggcgagaactctacatttttgatggctatgttggggcagaccgcaactat
cgccacggggtacgagtcatcaacgaattagcctctcaaaatttgtttgtccatcaactt
tttttgcgaccctctccagaggaattagccaaccatcaagccgattttaccgtcattgcc
gttccagggctgcatggcgaccccgaaatcgacggactgcggtcagaagcctttattgtc
ctgcatttaaccaaacggttagtgatcattggcggttctcgttatagcggagagatgaaa
aaatccgttttctccatgatgaattacgttatagcaaaagaaaacgtcttacccatgcac
tgcgctgccaatattgataaacgagcccatacgaccctcttttttggcttgtcgggaacc
ggaaaaactaccctatcggcagaccctgattgtagtttaattggggatgatgaacacggc
tggtcaaaagacggtattttcaactttgaaggaggatgttatgccaaaaccatccgcctt
tcccaagaaaacgaacctcaaatttgggcagccttacaatttggcacgttgctagaaaac
gtcatttttgaccccgaaacccgcaccccagactatgatgacagtcgcttaaccgaaaat
acccgcgctgcctatcccttacattacattcccaactgttccctctggggcatcggtagt
catcccaaaaccatctttttactgacagccgatgcctttggggtcttaccccccattgcc
aaactgacgaagcaacaggcgatgtatcattttctctcaggatataccagtaaactcgcg
ggaacagaacgggatgttacctcaccaaaagtcactttttcggcctgttttggtcaatgt
ttcttccccttgtctcctattgtctacgcacgaatgttaggagaacgcttagaacaacac
aacgatacccaagttttcctgttgaataccggatggtcagggggttcctatggggtaggc
catcgtatcccaatcaagcatacaagagcaatggtagcagcagcgttaaacggtcattta
gagaaagccaattatcatccccatcctatttttaaggtgttggttcctgaccatattgcc
ggagttcccaataaaattcttgacccgcaaaatacttgggacgaccctgaagcctatcaa
caacaagccttagacctagcccatcgttttatggagaatttccgacaattccacaatgtt
cccccagaaattgctcaagctggacccgtttgttaa

DBGET integrated database retrieval system