KEGG   Cyanobium sp. NIES-981: CBM981_0177Help
Entry
CBM981_0177       CDS       T04888                                 

Definition
(GenBank) conserved protein of unknown function
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cyi  Cyanobium sp. NIES-981
Pathway
cyi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cyi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CBM981_0177
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyi02000]
    CBM981_0177
Enzymes [BR:cyi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CBM981_0177
Transporters [BR:cyi02000]
 Other Transporters
  Pores ion channels [TC:1]
   CBM981_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_5 GST_C_2 GST_N_4 GST_C Glutaredoxin GST_N GST_C_3
Motif
Other DBs
NCBI-ProteinID: SBO41888
UniProt: A0A182AJY5
LinkDB All DBs
Position
I:complement(143471..144718)
Genome map
AA seq 415 aa AA seqDB search
MIEPLSWDELASRASTPADRVHGPTNAQALLRLFGHNARDVRVILYRDHHAWCPYCQKVW
LWLEERRIPYRIRKVTMVCYGTKEAWYRQRVPSGMLPAIEFDGRLITESDRILEALEQAF
GALAAGLHQPEVLPLRQLERLLFRSWCAWLCQPHRNGASDQQAQLQFQRTAAAMEAALEQ
TAGPWLLDRFSTADLVFVPYLERMNASLAYYKGFLLRQEHPTLHRWFTALEQRQTYRGTQ
GDFHTHAHDLPPQMGGCFATNSAIQMALARRIDAGPWPLTMADGSDPETSAPEPEDAAAV
ALERMLRHRRVLQERPALAGAAMDQALRCALTQLIGAGPCSPPPGTAAGLRSLRDRISVP
RDMPLHAARHLRQALEATAQRDPIASEAQAPALPVQHRRDQDPRPFVEASVASAL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagcccctgtcctgggatgagctggcctcccgggcatcaaccccggccgatcgc
gtgcatggccccaccaatgcccaggcgctcctgcggctgttcggccacaacgcgcgcgac
gttcgcgtcatcctttaccgggaccaccatgcctggtgcccctactgccagaaagtgtgg
ctctggctggaggagcggcggatcccttaccggatccgcaaggtcacgatggtgtgctac
ggcaccaaggaagcctggtaccgccaacgggtgccttccggaatgctgccggccatcgag
ttcgatggccggctgatcaccgagagcgaccgcatcctcgaggcgctggagcaggccttc
ggcgccctggcggcaggactgcatcagcctgaggtgttgcccctgcggcagctggaacgg
ctgctgttccggagctggtgtgcctggctctgccaaccccaccggaatggggccagcgac
cagcaggcccagctgcagttccagcgcacggccgcggcgatggaagcggctctggagcag
accgccggcccctggctgctggatcgattcagcacggccgatctcgtgttcgtgccctac
ctcgagcggatgaacgcttcgctggcctactacaaggggttcctgctgcgccaggagcat
cccaccctccaccgctggttcacggcccttgagcagcggcagacgtaccgcgggacccag
ggcgactttcacacccatgcccatgaccttcccccccagatggggggatgcttcgccacc
aacagcgccatccagatggccctggcccggcgcatcgatgcaggcccctggcccctcacc
atggccgatggttccgaccccgagacatcggcgccggagcccgaggatgccgcggccgtg
gccctggaacggatgctgcggcaccgcagagtgctgcaggagcgtcctgccctggctggc
gcggcaatggatcaggccctgcgctgcgccctcacccagctgatcggagctggcccctgt
tcgccaccccctggaaccgcggcgggtctgcgcagcctgcgcgatcgcatcagcgtgccg
cgcgacatgcccctgcatgcggcacggcacctgcgccaggcgctggaggccaccgcccag
cgcgatccgatcgcctccgaggcccaggccccagcgttgccggtgcagcaccgccgcgac
caggatccacgcccctttgtggaggcctccgtagcatcggccctgtga

DBGET integrated database retrieval system