KEGG   Cyanobium sp. NIES-981: CBM981_1173Help
Entry
CBM981_1173       CDS       T04888                                 

Gene name
gadA
Definition
(GenBank) glutamate decarboxylase A, PLP-dependent
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cyi  Cyanobium sp. NIES-981
Pathway
cyi00250  Alanine, aspartate and glutamate metabolism
cyi00410  beta-Alanine metabolism
cyi00430  Taurine and hypotaurine metabolism
cyi00650  Butanoate metabolism
cyi01100  Metabolic pathways
cyi01110  Biosynthesis of secondary metabolites
cyi01120  Microbial metabolism in diverse environments
cyi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cyi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CBM981_1173 (gadA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CBM981_1173 (gadA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CBM981_1173 (gadA)
   00430 Taurine and hypotaurine metabolism
    CBM981_1173 (gadA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CBM981_1173 (gadA)
Enzymes [BR:cyi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CBM981_1173 (gadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: SBO42884
UniProt: A0A182AMV7
LinkDB All DBs
Position
I:complement(1066266..1067654)
Genome map
AA seq 462 aa AA seqDB search
MALHLTRPTRADAVLHSEEFTRPLPRDRFPQHGQEAAATAEILSDELLLDGNSKQNLATF
CQTTEGPQVHALMDLAMDKNLIDKDEYPQTAELERRCVALLADLWHAPAGAIGCSTIGSS
EAAMLGGMAAKWRWRARQQAAGRPTDKPNMVCGSVQICWHKFARYWDIELREITMEPGRL
CLTAEDVLSRVDENTILVVPTLGVTYHGLYEDVASLSAALDGLQQRSGLDIPIHVDAASG
GFLAPFTAPHLPPWDFRLERVKSINASGHKFGLGPLGVGWVLWRQASDLPSELVFKVSYL
GGDMPTFQINFSRPAGQVIAQYYTFVQLGREGYRRIHAVSHAVAQVVAAALQAMPLFEVL
HDGNPHRGIPAVVWRLAPGQDPGFSLYDLADRLRVRGWQVPAYPLTGSLASTPFQRILVK
RGFTREMADLLVEDIRQAVDHLHNHPRAVPLSAEEAASYNHL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcacctcacgcgccccacccgggcggatgccgttctccacagcgaggagttc
acccggcccctgccccgcgaccgcttcccccagcacggccaggaggccgccgccaccgcc
gagatcctcagcgacgagctgctgctcgatggcaacagcaagcagaacctcgccaccttc
tgccagaccaccgagggcccccaggtgcatgccctgatggacctggccatggacaagaac
ctgatcgacaaggacgaatatccgcagacggcggagctggaacgccgctgtgtggccctg
ctggccgatctgtggcatgccccggccggcgccatcggctgctccaccatcggcagcagc
gaagcggccatgctcgggggcatggcggccaagtggcgctggcgtgcccgccagcaggcc
gccggccggcccacggacaagcccaacatggtgtgcggcagtgtgcagatctgctggcac
aagttcgcccgctactgggacatcgagctgcgcgagatcaccatggagcccggcaggctc
tgcctcaccgcggaggacgtgctcagccgggtggatgagaacacgatcctggtggtgccc
accctgggcgtgacttatcacgggctctacgaggatgtggccagcctcagtgccgccctc
gacggtctgcagcagcgctcaggcctcgacattcccatccatgtggatgcggccagtggg
ggctttctggcgcccttcaccgctcctcacctgccgccctgggatttccggctggagcgg
gtgaagtcgatcaacgcctcgggccacaagttcggcctcgggcccctgggggtgggctgg
gtgctgtggcgccaggccagtgatctccccagcgagctcgtgttcaaggtgagctacctg
ggcggcgacatgcccaccttccagatcaacttctccaggcccgccggccaggtgatcgcc
cagtactacacctttgtgcagctgggtcgtgagggctaccgccgcatccatgccgtgtcc
cacgccgtggcgcaggtggtggcggcggcgctgcaggcgatgccgctgttcgaggtgctg
cacgatggcaatccccatcgcggcatccctgccgtggtgtggcgtctggctccggggcag
gatcccggcttcagcctgtacgacctggccgaccggctgcgggtgcgtggctggcaggtg
ccggcctaccccctcaccggcagcctcgccagtacccccttccagcgcatcctggtgaag
cggggcttcacccgcgagatggccgacctgctggtggaggacatccgccaggcggtggac
catctccacaaccacccgcgggccgtgccgctctccgccgaggaagcggcgtcctacaac
catctgtga

DBGET integrated database retrieval system