KEGG   Cyanobium sp. NIES-981: CBM981_2754
Entry
CBM981_2754       CDS       T04888                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cyi  Cyanobium sp. NIES-981
Brite
Enzymes [BR:cyi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CBM981_2754 (sodB)
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: SBO44453
UniProt: A0A182ATD4
LinkDB
Position
I:2508952..2509551
AA seq 199 aa
MAHTLPTLPYGLDALEPHISRQTLEFHHGKHHNAYVTNLNKLVEGTDLDGKSLEDTITAV
AGDAGRAGVFNNAAQVWNHSFYWQCMKPGGGGQPTGALAEKINADFGSFEAFVEQFKTAG
ATQFGSGWAWLVLDGGTLKVTKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYIT
TYLEKLVNWDFVAANLAAA
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcccatacgctgcccacgctgccctacggcctcgatgcgctcgagccccatatctcc
cgtcagaccctcgagttccatcacggcaagcaccacaacgcctacgtcaccaacctcaac
aagctggtggagggcacggacctcgacggcaagagcctcgaggacaccatcacggccgtg
gcaggtgacgcgggcagggccggcgtgttcaacaacgccgcccaggtgtggaaccacagc
ttctactggcagtgcatgaagcccggtggtggtgggcaacccaccggcgccctggccgag
aagatcaatgccgacttcggcagcttcgaagccttcgtggaacagttcaagaccgccggc
gccacccagttcggcagcggctgggcctggctggtgctggacggcggcaccctcaaggtg
accaagaccgccaacgccgacctgcccctggcccatggccagaaggccctgctcaccatg
gacgtgtgggagcacgcctactacctcgactaccagaaccgccgccccgactacatcacc
acctacctcgagaagctggtgaactgggacttcgtggccgccaacctggccgctgcctga

DBGET integrated database retrieval system