KEGG   Cyanobium sp. NIES-981: CBM981_2756
Entry
CBM981_2756       CDS       T04888                                 

Definition
(GenBank) putative Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyi  Cyanobium sp. NIES-981
Pathway
cyi00010  Glycolysis / Gluconeogenesis
cyi00020  Citrate cycle (TCA cycle)
cyi00620  Pyruvate metabolism
cyi01100  Metabolic pathways
cyi01110  Biosynthesis of secondary metabolites
cyi01120  Microbial metabolism in diverse environments
cyi01200  Carbon metabolism
Module
cyi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBM981_2756
   00020 Citrate cycle (TCA cycle)
    CBM981_2756
   00620 Pyruvate metabolism
    CBM981_2756
Enzymes [BR:cyi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CBM981_2756
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: SBO44455
UniProt: A0A182ASM9
LinkDB
Position
I:complement(2510890..2512245)
AA seq 451 aa
MPALSSTMTEGKIVEWLKQPGERVERGESVLVVESDKADMDVEAFQEGFLAAVLMPAGGT
APVGETIGLIVETEEEIAAAAAAAPAAPAAATPAPAAATPAAAAAPAAPSPVPAPAPAPV
AAAPAPAPAAAPTVTVPVSAPAPSAGGRVVATPRAKKLAGQLGVDLGALRGSGPHGRIQA
EDVLAATGQPISVPRVAEGSAPAAAAGGNGASAPAPAPAGQTFGRPGEAVAFNTLQNAVN
RNMLASLAVPTFRVGYTITTTKLDAFYKQVKSKGVTMTALLAKAVAVTLARHPQVNAATS
ADGSAMAYPAAVNVAVAVAMEDGGLITPVLASADKTDIYALARSWADLVARARSKQLQPE
EYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAVAASRPCVVAGKDGSIRVANQMQVNLT
CDHRTIYGAHAAAFLKDLAQLIETNPESLAL
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgcccgccctctcctccacgatgacggagggcaagatcgtggagtggctcaagcagccc
ggtgagcgcgtcgagcgcggcgagtccgtgctggtggtggagagcgacaaggccgacatg
gatgtggaggccttccaggagggttttctcgccgcggtgctgatgccggctggtggcacc
gctcctgtgggtgagacgatcggcctcatcgtggaaaccgaggaggagatcgctgccgcc
gctgccgcggcacccgcagcccctgccgcggccactccggcaccggccgccgcaaccccc
gccgccgccgctgcgccggcggccccctcgccggttccggctcccgccccggcccctgtc
gctgcggccccggcacccgctccagccgccgctccaaccgtgacggtcccggtgagcgcc
ccggcgcccagtgccggggggcgggtggtggccacgccccgggcgaagaagctggccggc
cagctgggcgtggatctgggcgccctgcgcggcagcggtccccatggccgcatccaggcc
gaggacgtgctggccgccaccggccagcccatcagcgtgccccgggtggccgagggatcg
gcgccggctgccgctgccggcggcaacggtgccagtgcgccggcgccggcccccgccggc
cagaccttcggccgccccggcgaggccgtggccttcaacaccctgcagaacgcggtcaac
cgcaacatgctggccagcctggcggtgcccaccttccgggtgggttacacgatcaccacc
accaagctcgacgccttctacaagcaggtgaagagcaagggcgtcaccatgacggcgctg
ctggccaaggccgtggccgtcaccctggcccgccatccccaggtgaacgccgccacctcc
gccgacggcagtgccatggcctaccccgcggccgtgaacgtggccgtggccgtggcgatg
gaggacggcggcctgatcacgcccgtgctggccagcgcggacaagaccgacatctacgcc
ctggcccgcagctgggccgatctggtggcccgggcccgcagcaagcagctgcaaccggag
gagtacagcaccggcaccttcaccctcagcaatctgggcatgttcggcgtggatcgcttc
gatgcgatcctgccccccggcaccggcgccatcctggcggtggccgcctcccgcccctgc
gtggtggccggcaaggacggatcgatccgggtggcgaaccagatgcaggtgaacctcacc
tgcgaccaccgcaccatctacggggcccatgccgccgccttcctcaaggacctggcccag
ctgatcgagaccaaccccgagagcctggccctctga

DBGET integrated database retrieval system