KEGG   Cyanobium sp. NIES-981: CBM981_2756Help
Entry
CBM981_2756       CDS       T04888                                 

Definition
(GenBank) putative Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyi  Cyanobium sp. NIES-981
Pathway
cyi00010  Glycolysis / Gluconeogenesis
cyi00020  Citrate cycle (TCA cycle)
cyi00620  Pyruvate metabolism
cyi01100  Metabolic pathways
cyi01110  Biosynthesis of secondary metabolites
cyi01120  Microbial metabolism in diverse environments
cyi01130  Biosynthesis of antibiotics
cyi01200  Carbon metabolism
Module
cyi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBM981_2756
   00020 Citrate cycle (TCA cycle)
    CBM981_2756
   00620 Pyruvate metabolism
    CBM981_2756
Enzymes [BR:cyi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CBM981_2756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: SBO44455
UniProt: A0A182ASM9
LinkDB All DBs
Position
I:complement(2510890..2512245)
Genome map
AA seq 451 aa AA seqDB search
MPALSSTMTEGKIVEWLKQPGERVERGESVLVVESDKADMDVEAFQEGFLAAVLMPAGGT
APVGETIGLIVETEEEIAAAAAAAPAAPAAATPAPAAATPAAAAAPAAPSPVPAPAPAPV
AAAPAPAPAAAPTVTVPVSAPAPSAGGRVVATPRAKKLAGQLGVDLGALRGSGPHGRIQA
EDVLAATGQPISVPRVAEGSAPAAAAGGNGASAPAPAPAGQTFGRPGEAVAFNTLQNAVN
RNMLASLAVPTFRVGYTITTTKLDAFYKQVKSKGVTMTALLAKAVAVTLARHPQVNAATS
ADGSAMAYPAAVNVAVAVAMEDGGLITPVLASADKTDIYALARSWADLVARARSKQLQPE
EYSTGTFTLSNLGMFGVDRFDAILPPGTGAILAVAASRPCVVAGKDGSIRVANQMQVNLT
CDHRTIYGAHAAAFLKDLAQLIETNPESLAL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctctcctccacgatgacggagggcaagatcgtggagtggctcaagcagccc
ggtgagcgcgtcgagcgcggcgagtccgtgctggtggtggagagcgacaaggccgacatg
gatgtggaggccttccaggagggttttctcgccgcggtgctgatgccggctggtggcacc
gctcctgtgggtgagacgatcggcctcatcgtggaaaccgaggaggagatcgctgccgcc
gctgccgcggcacccgcagcccctgccgcggccactccggcaccggccgccgcaaccccc
gccgccgccgctgcgccggcggccccctcgccggttccggctcccgccccggcccctgtc
gctgcggccccggcacccgctccagccgccgctccaaccgtgacggtcccggtgagcgcc
ccggcgcccagtgccggggggcgggtggtggccacgccccgggcgaagaagctggccggc
cagctgggcgtggatctgggcgccctgcgcggcagcggtccccatggccgcatccaggcc
gaggacgtgctggccgccaccggccagcccatcagcgtgccccgggtggccgagggatcg
gcgccggctgccgctgccggcggcaacggtgccagtgcgccggcgccggcccccgccggc
cagaccttcggccgccccggcgaggccgtggccttcaacaccctgcagaacgcggtcaac
cgcaacatgctggccagcctggcggtgcccaccttccgggtgggttacacgatcaccacc
accaagctcgacgccttctacaagcaggtgaagagcaagggcgtcaccatgacggcgctg
ctggccaaggccgtggccgtcaccctggcccgccatccccaggtgaacgccgccacctcc
gccgacggcagtgccatggcctaccccgcggccgtgaacgtggccgtggccgtggcgatg
gaggacggcggcctgatcacgcccgtgctggccagcgcggacaagaccgacatctacgcc
ctggcccgcagctgggccgatctggtggcccgggcccgcagcaagcagctgcaaccggag
gagtacagcaccggcaccttcaccctcagcaatctgggcatgttcggcgtggatcgcttc
gatgcgatcctgccccccggcaccggcgccatcctggcggtggccgcctcccgcccctgc
gtggtggccggcaaggacggatcgatccgggtggcgaaccagatgcaggtgaacctcacc
tgcgaccaccgcaccatctacggggcccatgccgccgccttcctcaaggacctggcccag
ctgatcgagaccaaccccgagagcctggccctctga

DBGET integrated database retrieval system