KEGG   Cyanothece sp. PCC 7822: Cyan7822_0198Help
Entry
Cyan7822_0198     CDS       T01310                                 

Definition
(GenBank) Manganese/iron superoxide dismutase-like protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cyj  Cyanothece sp. PCC 7822
Brite
Enzymes [BR:cyj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cyan7822_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Phage_portal
Motif
Other DBs
NCBI-ProteinID: ADN12248
UniProt: E0UJK4
LinkDB All DBs
Position
complement(220583..221182)
Genome map
AA seq 199 aa AA seqDB search
MAYELPVLPYDYTALEPYISKSTLEFHHDKHHAAYVNNFNKAVAGTELDSLPIEEVIKKI
AGDSSKTGVFNNAAQAWNHTFYWNSLKPNGGGTPSGAIADKINADFGSFEKFVEEFKNAG
ATQFGSGWAWLVLDNGTLKVTKTPNADNPLTAGQVPLLTMDVWEHAYYLDYQNKRPDYIE
TFISKLINWEFVNQNLAHA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaattacctgtattaccttatgattacacggctctagagccttatatttcc
aaatcaacccttgagtttcaccacgacaagcaccacgcggcttatgtcaataactttaat
aaagctgtggcgggaactgaattagactcattacccattgaagaagtaatcaaaaagata
gccggtgattcttccaagacaggtgttttcaacaatgcggctcaagcgtggaatcacacc
ttttattggaattccctaaaacccaatggcggcgggactcctagcggtgctatcgctgat
aaaatcaatgctgatttcggtagctttgagaaatttgttgaagaatttaaaaatgctggt
gctactcaatttggtagcggctgggcttggttagtgctggacaatggaaccttaaaagtt
accaaaaccccgaacgctgacaaccccttaacggcaggtcaagttcccctactaactatg
gatgtatgggaacacgcttactacttagattatcaaaacaagcgtcctgactacatcgag
acatttatcagcaaacttatcaattgggaattcgttaaccaaaacttagcccacgcttag

DBGET integrated database retrieval system