KEGG   Cyanothece sp. PCC 7822: Cyan7822_1897Help
Entry
Cyan7822_1897     CDS       T01310                                 

Definition
(GenBank) Glutathione S-transferase domain protein
Organism
cyj  Cyanothece sp. PCC 7822
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 GST_C_5 GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ADN13881
UniProt: E0UAM9
LinkDB All DBs
Position
2085278..2085985
Genome map
AA seq 235 aa AA seqDB search
MFSESLPELVFYFNRNCPYAQRTWIALLELNVNFQPREIELGSDNKTDWFLSLNPNGKVP
VIEQGETRVYESLIVNEYLSEISGNKLMPSSAGKRALARILMARCDSHLVKTSFSYLAHK
SAENLEKEEQLKSELEAELRFLDTVIGESGDSYFLGEFTLTDIAFIPFFQRLAVTLPAFK
NFEISQNNFPHLNRWLETMASRESCIQTAMKAEAIKEIYARFLKIDYFKKIGVAT
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgaatctttaccagaactcgttttttatttcaaccgtaactgtccttatgct
caacggacttggatagcattacttgagttaaatgtcaactttcagcctagagaaattgaa
ttaggttcggataacaaaaccgattggtttttatcgttaaatcctaatggcaaagtcccc
gtcattgaacagggagaaacccgagtctatgaatccttaattgttaatgaatatctctcg
gaaatttcgggaaataaattaatgccttcctcggcaggaaaaagggcattagctcgaatt
ttaatggctcggtgtgattctcatttagtgaaaacttcctttagctatctggctcataaa
tcagcagaaaatctcgaaaaagaagaacaattaaaatctgagttagaggcggaattacgc
tttttggatacagtcattggcgagtctggcgattcttattttttaggagaattcacctta
acagacattgcttttattccgtttttccaaagattagccgtgactttacccgcttttaaa
aattttgaaattagccaaaataattttcctcatcttaaccgttggttagagacaatggct
tctcgtgaaagttgtattcaaaccgccatgaaagctgaggcgattaaagaaatttatgcc
cgctttttaaaaattgattattttaaaaaaatcggagtagctacctga

DBGET integrated database retrieval system