KEGG   Gloeothece verrucosa: Cyan7822_3414Help
Entry
Cyan7822_3414     CDS       T01310                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
cyj  Gloeothece verrucosa
Brite
KEGG Orthology (KO) [BR:cyj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cyj01001]
    Cyan7822_3414
Enzymes [BR:cyj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Cyan7822_3414
Protein kinases [BR:cyj01001]
 Serine/threonine kinases: Other
  Bacterial family
   Cyan7822_3414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH DUF1828
Motif
Other DBs
NCBI-ProteinID: ADN15364
UniProt: E0UEB8
LinkDB All DBs
Position
complement(3777428..3779227)
Genome map
AA seq 599 aa AA seqDB search
MYRSYYRILGLIGQGQFGRVFCAVDRQTGEIVALKDLELKRFPTHKFLREISYLLTLKHP
NIVGCTGLEYNRTGRYVVMDYCEGGTLRDLINSQEQLSLKQKLNLVEDILSGLAHAHSRQ
IIHCDIKPENILLKLKPSSWSAHISDFGIARLIEEINSQSGGYTGSPAYMAPERFYGKHS
FASDLYAVGIILFELLVGYRPFSGYPGELMTAHLSKTVTIPNTIPPLLSSIIEKALRKLP
QRRFKSTEEMLKSVRLASETLGFNSSSVQLFTSLSSVPNATSLNIIHQVSLPQRVSHLAV
DKQCVYLGIEDKLCCQIYPDSSLVGKPQEWQVPLKGSLVKLFSHSQGCLTVTDSPVNEGS
CISYFRKSHDAGQIFQQQQVCVSRLNQISAIAPGGHWLAFISSSQVLQFLKLPNLERVKT
SINCSIDSQLVTLDSRHGMIINSAEEKKPKTQFTLLTRRGNLWRFFSLSISLHSLVSNSH
LPDQIFALEVSEKILGILINLKPLKVTRIPLEIKPDFILGQPWGFLLASRQGKVILLGIR
GEKLGGFQVEEEITAMAFYDQFRLLMATDYQSEKRLYFINLEEKLANKIYLNSNSNTLS
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgctcctattaccgaattttaggacttattggacagggacagtttggtcgagta
ttttgtgctgttgaccgtcaaacgggagaaattgttgcacttaaggatttggaacttaag
cgctttcctactcataagtttttgcgagaaatttcctacttactgactctaaaacatcct
aatattgttggctgtacgggtctagaatataatcggacgggtcgttatgtggtgatggac
tactgtgagggaggaacgttacgagatttaattaactcccaagagcaattaagtttaaag
caaaagttaaacttagtagaagatattctatcaggtttagctcatgcccatagccgtcaa
atcattcattgtgatattaaacccgagaatattttactgaagctaaaaccgagtagttgg
agtgcccatatttctgattttggcattgctcgcttgatagaagaaattaatagtcaaagt
ggcggctatacgggttcgccagcttatatggccccagaacgattttatggaaaacattct
tttgcttcagatttatatgctgttggtattattttgtttgagcttttagtgggataccgt
cctttttctggctatcctggcgaattgatgacagcgcatttgagtaagacagtaacgatt
cctaatacgattcctcctttactcagttctatcattgaaaaagctttgcgtaagttgccg
caacgacggtttaaaagtaccgaggaaatgttaaaatctgttcgtctcgcttcggaaaca
ttaggctttaattcgtcttcggtgcaattatttacttcgctgtcttctgtccctaatgcc
acttcattaaatattattcatcaagtttctttacctcaacgagttagccatttagcggtg
gataagcagtgtgtttatctgggaatagaagataaactttgttgtcaaatttatcccgat
tctagtttagtgggaaaacctcaagagtggcaggttcccttgaagggttcattagttaag
ttattttctcattctcaaggatgtttaactgttacagactcgccagttaatgaaggttct
tgtatttcctattttcggaaatctcatgatgcaggacaaatttttcagcaacagcaagtc
tgtgtatctagactgaatcaaattagtgctattgcacctggaggtcattggttagctttt
atatcttcttctcaggttttgcaatttctgaaattgcccaatttagaacgagttaaaact
tctattaattgttcaattgactctcaattagttacgctagatagtcgtcatggaatgatt
attaattcggctgaagaaaaaaagccgaaaacacaatttacattattgactagacgcggg
aatttatggaggtttttttctttatctattagtcttcattcgctcgtctctaattcacat
ttgcctgatcagatttttgctctagaagtgagtgaaaaaatcttaggaattttgattaat
ttaaaacctttaaaagtcactcgcattcccttagaaattaaaccggattttattttagga
cagccttggggttttttattagcttctcgtcaaggaaaggttattttattgggtattaga
ggggaaaagttaggcggctttcaagtggaagaggaaatcacggcgatggctttttatgat
cagtttaggcttttaatggctactgattaccagtcagaaaaaagattgtattttattaat
ttagaggaaaaactcgctaataagatttatttaaatagtaattcaaacactttatcttga

DBGET integrated database retrieval system