KEGG   Cyanothece sp. PCC 7822: Cyan7822_3921Help
Entry
Cyan7822_3921     CDS       T01310                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cyj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Cyan7822_3921
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyj02000]
    Cyan7822_3921
Enzymes [BR:cyj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Cyan7822_3921
Transporters [BR:cyj02000]
 Other Transporters
  Pores ion channels [TC:1]
   Cyan7822_3921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ADN15851
UniProt: E0UK89
LinkDB All DBs
Position
4328528..4329178
Genome map
AA seq 216 aa AA seqDB search
MLKLYHATISPNSRRVWVTLLEKGLDFELIEVELTGEQFKPDFLAINPFHHIPVLVDDGH
NVIESLAILDYLEAKYPTPTMLPNNPKDLSIVRMVQFVTANELLPAGSALFPVMLGLPGG
DAEKIAKAKEKIAVVLKFFEGLLDERPFFGSDNITLADAVAGTVVPWLPKAGVSLQDYPK
LSAWCHGLLARPSWQKTEASKEILEAIKSRMAARMS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagctttatcatgctacgatttcgcctaattctcgccgtgtttgggttactctt
ttggaaaagggtctagattttgaattgattgaagttgagttaactggggaacagtttaag
ccggatttcttggcgatcaatccttttcatcatattccggttttggtggatgatggtcat
aatgtaattgaatctttggctattttggattatttggaggctaaatatcctactccgact
atgttacccaataaccccaaggatttgtcaatcgtgcgaatggtacagtttgtaacggct
aatgaattattgcctgccggaagtgctttgtttcctgtgatgttagggttgcctggagga
gatgcagaaaaaattgccaaagctaaagagaaaattgctgtcgtgttgaagttttttgag
ggtttgcttgatgaacgtcctttttttggcagtgataatattactctggctgatgcggtt
gcgggtactgttgttccttggttgccaaaagcgggagtgtctttacaagattatcctaaa
ttgagtgcttggtgtcatggccttttagcacgtccttcttggcaaaaaacagaggcaagt
aaagagattcttgaagccatcaagtctcgaatggcggcgagaatgtcataa

DBGET integrated database retrieval system