KEGG   Cyanothece sp. PCC 7822: Cyan7822_3928Help
Entry
Cyan7822_3928     CDS       T01310                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00910  Nitrogen metabolism
cyj02010  ABC transporters
Module
cyj_M00438  Nitrate/nitrite transport system
cyj_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:cyj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Cyan7822_3928
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Cyan7822_3928
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyj02000]
    Cyan7822_3928
Transporters [BR:cyj02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Cyan7822_3928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Peptidase_A8
Motif
Other DBs
NCBI-ProteinID: ADN15858
UniProt: E0UK96
LinkDB All DBs
Position
4336516..4337358
Genome map
AA seq 280 aa AA seqDB search
MNPTLKIRNKKNPWLTSLVALFNKSPRKIIAPIIALGIFLTIWQILCSGENPNLPSPLTV
LKETWNPLIINPFYDNGGTDKGLFWQILASLQRVGIGFSLAALVGISVGVLIGASPLMYD
ALDPIFQVLRTIPPLAWLPISLAAFRQSDPSAIFVIFITAIWPIIINTTVGVQQIPQDYR
NVSRVLQLSKIEYFFNILIPSAVPYIFTGLRIGIGLSWLAIVAAEMLVGGVGIGFFIWDA
YNSSRLGQIILALIYVGVVGLLLDRMVGFIGNLIVPEEQK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctactctaaaaattagaaataagaaaaacccttggctaacttccttagtcgcc
ttatttaacaaatctccgagaaaaattattgcccctattattgctctggggatattctta
acaatttggcaaatcctttgttcaggagaaaaccctaatttaccttctccgttaacggtt
ttaaaagagacttggaaccccttgattattaacccattttatgataatggcggcacagac
aaaggcttattttggcaaatattagccagtttacaacgggtaggcataggtttttcccta
gccgcgctagtaggaattagtgtaggggttctgatcggtgcaagtccgttaatgtacgat
gccttagacccaatatttcaagtcttaagaaccattccccctttagcctggttacccata
tccttagccgcctttcggcaatccgatccatcagccatctttgtaatattcattacagca
atttggccaatcatcatcaacaccaccgtaggagtacaacaaatccctcaagactatcgc
aacgtctcacgagtcttacaactctcaaaaatagaatacttctttaacatattaatcccc
tccgccgtcccttacatcttcaccggactaagaataggaatcggcttatcatggttagcc
atcgtagccgcagaaatgttagtcggaggagtcggaatcggctttttcatctgggacgct
tacaacagttcacgcctaggacaaatcatactcgccctaatctacgtcggagtcgtcggc
ctcttactagacagaatggtcggatttatcggtaacctcatcgtcccagaagaacaaaaa
taa

DBGET integrated database retrieval system