KEGG   Cyanothece sp. PCC 7822: Cyan7822_5640Help
Entry
Cyan7822_5640     CDS       T01310                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00500  Starch and sucrose metabolism
cyj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyan7822_5640
Enzymes [BR:cyj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Cyan7822_5640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Yeast-kill-tox
Motif
Other DBs
NCBI-ProteinID: ADN17505
UniProt: E0UKM5
LinkDB All DBs
Position
Cy782201:complement(61376..63847)
Genome map
AA seq 823 aa AA seqDB search
MSIFHNQDNFMNVKRWLWVNLITLCCVLSLGTNVAWAVGGGQAPGAPGVPSVWSYAGKQG
IGTSYENYVNNIYQDNVATGVVSKVWFTLAQGIITETAYGEIDLAQINDLQFLVTGNGFF
DQEKVDTNSKVDYLDKDSSGRPLSPAYRVVNTGKNGKYTIEKHIFTDPNRQTLFTRVIFT
ANEDNITPYILINPHMNNTGSNDVAFVRADSLNAREQEKVYLSLKSSEPFVKTSAGYVGR
TDGYQDLQQNGVMDWTYDYTDQNAPGNVAMMAQLPTFKAGETRTFDIVVGFGNSYNTATA
EADGSLQEGYASVLAKYNGTGNAVGWEDYISSLSNLAAMVPNTGDNGKELYASAFTLKTM
EDKANAGALIASLSVPWGNTVNADIFATGYRAVWPRDFYQVAMALLALGDKQTPLVAFRY
LPKVQVKPAANGQPGTLGNSGTTGWFLQKTHVDGTLEWLGVQLDQTAMPIMLGWKLWKAG
ILSDRQISDAYHATLKPAAEFLSNGGPINIRTPNQQNIRQITPPITHQERWEEQYGYSPS
TTAAVITGLVVAADIAQNAANDPGAANYYLQKADEFQNNVDKSMFTTNGLTTPCNNPGQY
FLRIDQDGNPNNNGQIDASNGKTPIGEVKVLDGGFLELVRFGVKPANDSHISSTICQFDG
ISDNSPEQDLNIKYNFTFDGKEYPGFRRYGHDGYGEITTDGSNYLGVLPNQRGRVWPIFT
GERGHYELELAKATNGGSISDQQVAQLRDIYVRAIEYFANDSFMIPEQVWDGVGSNDTYH
YIVGEGTNSATPLAWSHAEYIKLVKSLTDKNIWDSYSIVRERY
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttttcacaatcaagataattttatgaatgttaaacgttggctatgggttaac
ttaattaccctttgttgtgttttatcgctaggaacaaatgttgcttgggcagtaggtggc
ggtcaagcacctggggcccccggagttccctctgtttggtcttatgccggcaaacaaggt
attggcacatcctatgagaactatgttaataacatttatcaggataatgtcgctacagga
gtggtttccaaagtttggtttactttagcacaaggaattattacagaaaccgcttatgga
gaaattgaccttgctcagatcaacgatttacagtttttagtaaccggtaatggatttttt
gatcaagaaaaagtagataccaatagcaaagtagattatctcgataaagatagcagtggt
cggccattgtctcctgcttatcgagtcgttaacactggtaaaaatggtaaatatactatc
gaaaaacatatttttaccgatccaaaccgtcaaactttatttacccgagtcatttttacg
gccaatgaggataacatcacgccctacattttgatcaatcctcacatgaataatacgggt
agtaatgatgtggcttttgttcgcgcagatagtcttaatgctcgtgaacaagaaaaggtc
tatttaagcttaaaaagcagcgagccttttgtcaaaacatcagccggatatgtaggcaga
actgatggctatcaagaccttcaacaaaatggagtgatggactggacttatgattataca
gaccaaaatgctccaggtaatgtggcgatgatggctcaattacctacttttaaggcagga
gaaacccgaacttttgatatagtggtgggatttggcaatagttataacaccgctacagca
gaagcagacggttctttacaagaaggttacgcgagtgtgttggccaaatacaacgggaca
ggaaatgccgttggatgggaagattatatctctagtttgagcaatttagcggctatggtg
cccaataccggggataatggtaaagagctttatgctagtgccttcaccttaaaaacgatg
gaagataaagccaatgcaggggcattaattgcttctttatcagtgccttggggtaataca
gtgaacgcagatatttttgccactggatatcgggcagtttggccaagagatttttatcaa
gtggctatggctttattagcattaggagataaacaaactcctcttgtcgcttttcggtat
ttacctaaagttcaagttaagcccgccgccaatggacagcccggaactttgggaaattct
gggactacaggttggtttttgcaaaaaactcacgttgatggaactttagaatggcttggc
gtacagctagatcaaaccgctatgccgatcatgttgggttggaaattgtggaaagcgggt
attctctctgatcgtcaaatcagcgatgcctatcatgctacattgaaaccagccgccgag
tttttaagtaatggagggccaattaatattcgtactcctaatcagcaaaacattcgtcaa
atcactcctcctattactcaccaagaacgatgggaagaacaatatggttattctccttca
acaactgctgctgttattactgggttagtcgtggcggctgatattgcccaaaatgccgct
aatgatccaggtgcagccaattattatttacagaaagcggatgaatttcaaaacaatgtg
gataagtctatgtttactaccaatggactaaccacaccctgtaacaaccccggtcaatat
ttcttaagaattgaccaagatggaaatcctaataacaatggccaaattgatgccagcaat
ggaaaaacgcctattggcgaagtaaaggttttagatggcggctttttagaattagttcgt
tttggcgttaaaccggctaatgattctcatattagctctactatttgccaatttgatggc
ataagcgacaattcgccagagcaggatttaaatattaagtacaattttacttttgatggt
aaagaatatccaggtttcagacgctatggccatgatggttatggagaaattactactgat
ggttctaactatcttggcgttttacctaatcaacgaggacgagtttggccgattttcaca
ggtgaacgaggacattatgaattagaattagctaaggcgacaaatggcggaagcattagc
gatcaacaagtggctcaactgcgcgatatttatgttcgagcaatagagtattttgctaat
gatagctttatgattcctgagcaagtttgggatggagtgggcagtaatgacacctatcat
tatatcgttggagaaggaacaaacagtgcaacgcctctagcttggagtcatgccgaatat
atcaaattagttaaatctttaactgataagaatatctgggattcttattctattgttcgg
gaaagatattaa

DBGET integrated database retrieval system