KEGG   Cyanothece sp. PCC 7822: Cyan7822_5861Help
Entry
Cyan7822_5861     CDS       T01310                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
cyj  Cyanothece sp. PCC 7822
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ADN17715
UniProt: E0UL85
LinkDB All DBs
Position
Cy782201:363255..365096
Genome map
AA seq 613 aa AA seqDB search
MIKPEIEFFQEIKSESFTLLNLLAHRANKEPNKIGYKFLQRGETVSKITYLELELQAQVI
AYSLQSLKLEGERVLLLYPSGLDFIKAFFGCLYAGLIAVPAYPPRASQHISRLLSITNDA
KATIALTTSSILKSLESEINKHPELKSLQWLATDTLDNELAKEWTKPNITPKTLAFLQYT
SGSTGKPKGVMVSHENLLHNLSLIYSCFAHSEQSQGVIWLPPYHDMGLIGGILQPLYGGF
PVCLMAPMDFLQRPLRWLQAISQHQATTSGGPNFAYDLCLQKISPEERDQLDLSSWKVAF
TGAETIRAKTLEQFAEYFAPCGFRKEAFYPCYGMAETTLIVTGGKVTDPPVICEIDGNSL
EQNKVLPVQNPEHSKQLVGCGQNLPNQKTLIVNPETLIECLPEEVGEIWVSSSSVAQGYW
EQPEETKKVFKAYLADKVQGPFLRTGDLGFIRDGELFVTGRIKDLIIIRGQNYYPQDIEL
AVEKSHPALRSNSGAAFSVEMKGQEKLIIVQEVERTYLRNLNINEIVSSIRQVVTKEFEL
QVYATVLVKPASIPKTSSGKIQRHRCREQFLQGTLSIVEDWCETPHGKVKFLHLQNEVDN
LFKQLSNLNPTQK
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgattaagccagaaatagaattttttcaggagattaaatccgaaagttttacattgctc
aatcttttagctcatcgtgctaacaaagaacctaacaaaattggttataagtttcttcag
cgaggtgaaactgtatctaaaataacatacttagaattagaattgcaagcacaagtaatt
gcttattctttacaatctttaaaacttgagggagagcgagttttactgctatatccatcg
ggattagattttatcaaagcctttttcggatgtttgtatgcaggtttaatcgctgtacca
gcctatccgcctcgtgcgagtcagcatatatcccgtttactctccattaccaatgatgct
aaagcaacaatcgctttaacaacctcctcaattttaaaatctttagaatcagaaataaat
aaacatcctgaattaaaatctttgcaatggttagcaacagatactttagataatgaatta
gccaaagaatggactaaacccaacataaccccaaaaaccttagcatttcttcaatataca
tctggctctacaggtaagccgaaaggggtaatggtaagccatgaaaatctgttgcacaat
ttatccttaatttattcatgttttgcccattctgagcagagtcagggagtgatttggtta
cccccctatcatgatatgggattaatcggaggaatattacagccgctttacggaggattt
ccggtgtgtttgatggcaccgatggactttttacaaaggcccctgcgttggttacaagcc
atttcgcagcaccaagccaccaccagtggcgggccgaattttgcttatgatttgtgccta
caaaaaatctctccagaagaacgagatcaactagacttaagtagctggaaagtagccttt
actggcgcagaaaccatcagagcaaaaaccttagaacaatttgccgaatattttgcgcct
tgtggttttcgcaaagaagctttctacccttgttatgggatggctgaaacaaccctaatt
gttacaggtggaaaagtaacagatccgccagttatttgtgaaattgatggcaatagtctt
gagcaaaataaagtcttacctgtacaaaaccccgaacatagtaaacaattggtaggctgt
ggacaaaacctacccaatcaaaaaaccctaattgtcaatcccgaaactttaatcgaatgt
ttacccgaagaagtaggagaaatttgggtcagcagttcaagcgtagctcaaggttactgg
gagcaacctgaagaaaccaaaaaagtatttaaagcttatttagcagacaaggttcaagga
ccatttttacgcacaggagacttaggctttatcagagatggagagttatttgtcaccggc
agaataaaagatttaattattattcgcggacaaaattactatcctcaagatatagaactg
gcagtagaaaaaagccatccagccttacgttctaatagcggcgcggctttttcagtagaa
atgaaaggacaagaaaaattaattattgtccaagaagtagaacgaacttacttacgaaat
ttaaatattaatgaaattgtaagtagtattcgtcaagtagtaacgaaagaatttgaactt
caagtttatgctacggttttagttaaacccgccagtattcccaaaacatcaagtggaaaa
attcaacgccatcgctgccgggagcaatttcttcaaggaactttgagtatagttgaagat
tggtgtgaaacccctcatggaaaagtaaaatttttgcatttacaaaatgaagtagataat
ttatttaaacaattatctaacttgaacccaactcagaaatag

DBGET integrated database retrieval system