KEGG   Cyanobacterium sp. HL-69: AA637_00330
Entry
AA637_00330       CDS       T05309                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) PdhC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyl  Cyanobacterium sp. HL-69
Pathway
cyl00010  Glycolysis / Gluconeogenesis
cyl00020  Citrate cycle (TCA cycle)
cyl00620  Pyruvate metabolism
cyl01100  Metabolic pathways
cyl01110  Biosynthesis of secondary metabolites
cyl01120  Microbial metabolism in diverse environments
cyl01200  Carbon metabolism
Module
cyl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA637_00330 (pdhC)
   00020 Citrate cycle (TCA cycle)
    AA637_00330 (pdhC)
   00620 Pyruvate metabolism
    AA637_00330 (pdhC)
Enzymes [BR:cyl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AA637_00330 (pdhC)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Other DBs
NCBI-ProteinID: AUC59679
UniProt: A0A2K8WKR8
LinkDB
Position
73830..75083
AA seq 417 aa
MPALSSTMTEGKIVSWEKAPGDKVEKGETVVVVESDKADMDVESFYSGYLATILVDAGEE
APVGAAIAYIAETEAEIEEAKKKASSAPSSSNGASAPKVEETVEPTAPEPVATTTINAPS
GRLIASPRAKKLAKEFKVDLTTVAGTGLNGRITAEDVEKVAGKAPSRPTAAPVSAVTTPP
VAQAIAPAPVNNHAGETVPLNTLQQAVVRNMMASLQVPTFHVSYDITTDALDALYRQIKP
KGVTMTALLAKAVAVTLQKHSIVNSSYTDAGIKYNEGINIAIAVAIPDGGLITPVLKNAD
QVDIYSLARSWKDLVSRARAKQLQPDEYSTGTFTISNLGMFGVSSFDAILPPGQGSILAV
GGARPTVVSDGQGFFGVKNQMTVNITCDHRNIYGADAASFLKDLAQLIESETHSLTL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgcccgccctcagctctactatgaccgagggaaaaatagtttcatgggaaaaagctccg
ggagataaggttgagaagggagaaaccgtcgttgtggtcgaatcagacaaggcggatatg
gatgtagaatctttttattctggttatttagccactattttagtggatgctggagaagaa
gcccccgtaggtgctgccattgcatacattgccgaaactgaggcggaaattgaggaagcg
aagaaaaaagcaagtagcgcccctagttcatccaatggtgcatcggctccgaaggtagag
gaaacggttgaacctacagcccctgaacctgtagcaactacgacgattaatgcacctagt
ggcaggttaattgcttctccccgtgccaaaaaattagctaaggaatttaaggttgattta
actaccgttgcaggtactggtttaaatggacgcatcactgctgaggatgtggaaaaagtt
gcaggaaaagcacctagtcggcccactgcagcccctgtttctgcggttacaactcccccc
gttgctcaggcgatcgcccctgctcctgtaaacaaccatgctggggaaactgttcctctc
aatactctacaacaggcggtagtcagaaacatgatggcgagtttacaagtgcctaccttc
catgtgagttacgacattaccaccgatgccctcgatgccctttaccgtcaaattaagccc
aagggtgtcaccatgactgctttactcgctaaggcggtggctgttactttacaaaaacac
tccatcgttaactctagttacaccgatgctggtatcaaatacaatgaaggaatcaacatt
gcgatcgccgttgccatacccgatggcggtttgattacccccgtgttaaaaaatgctgac
caagtagatatttattcccttgcccgtagctggaaagatttggtatccagagccagagca
aaacaactacaacccgatgagtatagcacgggtacttttaccatttccaacctcggtatg
tttggtgtcagtagttttgacgctattttacctcccggacagggttctatcctcgcagta
gggggcgctcgtcctacggtggtatccgatggacagggtttctttggggtaaaaaatcag
atgactgttaatattacctgtgatcatcgtaatatttatggagcggatgcggcttctttc
ctcaaggatttagcccagttgattgagtctgaaacccattctttaactctctaa

DBGET integrated database retrieval system