KEGG   Cyanobacterium sp. HL-69: AA637_00330Help
Entry
AA637_00330       CDS       T05309                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) PdhC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyl  Cyanobacterium sp. HL-69
Pathway
cyl00010  Glycolysis / Gluconeogenesis
cyl00020  Citrate cycle (TCA cycle)
cyl00620  Pyruvate metabolism
cyl01100  Metabolic pathways
cyl01110  Biosynthesis of secondary metabolites
cyl01120  Microbial metabolism in diverse environments
cyl01130  Biosynthesis of antibiotics
cyl01200  Carbon metabolism
Module
cyl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA637_00330 (pdhC)
   00020 Citrate cycle (TCA cycle)
    AA637_00330 (pdhC)
   00620 Pyruvate metabolism
    AA637_00330 (pdhC)
Enzymes [BR:cyl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AA637_00330 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Motif
Other DBs
NCBI-ProteinID: AUC59679
UniProt: A0A2K8WKR8
LinkDB All DBs
Position
73830..75083
Genome map
AA seq 417 aa AA seqDB search
MPALSSTMTEGKIVSWEKAPGDKVEKGETVVVVESDKADMDVESFYSGYLATILVDAGEE
APVGAAIAYIAETEAEIEEAKKKASSAPSSSNGASAPKVEETVEPTAPEPVATTTINAPS
GRLIASPRAKKLAKEFKVDLTTVAGTGLNGRITAEDVEKVAGKAPSRPTAAPVSAVTTPP
VAQAIAPAPVNNHAGETVPLNTLQQAVVRNMMASLQVPTFHVSYDITTDALDALYRQIKP
KGVTMTALLAKAVAVTLQKHSIVNSSYTDAGIKYNEGINIAIAVAIPDGGLITPVLKNAD
QVDIYSLARSWKDLVSRARAKQLQPDEYSTGTFTISNLGMFGVSSFDAILPPGQGSILAV
GGARPTVVSDGQGFFGVKNQMTVNITCDHRNIYGADAASFLKDLAQLIESETHSLTL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctcagctctactatgaccgagggaaaaatagtttcatgggaaaaagctccg
ggagataaggttgagaagggagaaaccgtcgttgtggtcgaatcagacaaggcggatatg
gatgtagaatctttttattctggttatttagccactattttagtggatgctggagaagaa
gcccccgtaggtgctgccattgcatacattgccgaaactgaggcggaaattgaggaagcg
aagaaaaaagcaagtagcgcccctagttcatccaatggtgcatcggctccgaaggtagag
gaaacggttgaacctacagcccctgaacctgtagcaactacgacgattaatgcacctagt
ggcaggttaattgcttctccccgtgccaaaaaattagctaaggaatttaaggttgattta
actaccgttgcaggtactggtttaaatggacgcatcactgctgaggatgtggaaaaagtt
gcaggaaaagcacctagtcggcccactgcagcccctgtttctgcggttacaactcccccc
gttgctcaggcgatcgcccctgctcctgtaaacaaccatgctggggaaactgttcctctc
aatactctacaacaggcggtagtcagaaacatgatggcgagtttacaagtgcctaccttc
catgtgagttacgacattaccaccgatgccctcgatgccctttaccgtcaaattaagccc
aagggtgtcaccatgactgctttactcgctaaggcggtggctgttactttacaaaaacac
tccatcgttaactctagttacaccgatgctggtatcaaatacaatgaaggaatcaacatt
gcgatcgccgttgccatacccgatggcggtttgattacccccgtgttaaaaaatgctgac
caagtagatatttattcccttgcccgtagctggaaagatttggtatccagagccagagca
aaacaactacaacccgatgagtatagcacgggtacttttaccatttccaacctcggtatg
tttggtgtcagtagttttgacgctattttacctcccggacagggttctatcctcgcagta
gggggcgctcgtcctacggtggtatccgatggacagggtttctttggggtaaaaaatcag
atgactgttaatattacctgtgatcatcgtaatatttatggagcggatgcggcttctttc
ctcaaggatttagcccagttgattgagtctgaaacccattctttaactctctaa

DBGET integrated database retrieval system